|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1HAJ) |
(no "Site" information available for 1HAJ) |
NMR Structure
|
(no "Cis Peptide Bond" information available for 1HAJ) |
(no "SAP(SNP)/Variant" information available for 1HAJ) |
NMR Structure (1, 1)
|
(no "Exon" information available for 1HAJ) |
NMR StructureChain A from PDB Type:PROTEIN Length:74 aligned with 3L21A_BUNMU | P60615 from UniProtKB/Swiss-Prot Length:95 Alignment length:74 31 41 51 61 71 81 91 3L21A_BUNMU 22 IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG 95 SCOP domains d1haja_ A: Bungarotoxin SCOP domains CATH domains 1hajA00 A:1-74 CD59 CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------SNAKE_TOXIN ----------- PROSITE Transcript -------------------------------------------------------------------------- Transcript 1haj A 1 IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG 74 10 20 30 40 50 60 70 Chain A from PDB Type:PROTEIN Length:74 aligned with 3L21V_BUNMU | P60616 from UniProtKB/Swiss-Prot Length:95 Alignment length:74 31 41 51 61 71 81 91 3L21V_BUNMU 22 IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG 95 SCOP domains d1haja_ A: Bungarotoxin SCOP domains CATH domains 1hajA00 A:1-74 CD59 CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE (2) ------------------------------------------SNAKE_TOXIN ----------- PROSITE (2) Transcript -------------------------------------------------------------------------- Transcript 1haj A 1 IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG 74 10 20 30 40 50 60 70 Chain B from PDB Type:PROTEIN Length:13 SCOP domains ------------- SCOP domains CATH domains ------------- CATH domains Pfam domains ------------- Pfam domains SAPs(SNPs) ------------- SAPs(SNPs) PROSITE ------------- PROSITE Transcript ------------- Transcript 1haj B 75 WRYYESSLEPYPD 87 84
|
NMR Structure |
NMR Structure
|
(no "Pfam Domain" information available for 1HAJ) |
NMR Structure(hide GO term definitions) Chain A (3L21V_BUNMU | P60616)
Chain A (3L21A_BUNMU | P60615)
|
|
|
|
|
|
|