|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2ABX) |
(no "Site" information available for 2ABX) |
Asymmetric/Biological Unit
|
(no "Cis Peptide Bond" information available for 2ABX) |
(no "SAP(SNP)/Variant" information available for 2ABX) |
Asymmetric/Biological Unit (1, 2)
|
(no "Exon" information available for 2ABX) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:74 aligned with 3L21A_BUNMU | P60615 from UniProtKB/Swiss-Prot Length:95 Alignment length:74 31 41 51 61 71 81 91 3L21A_BUNMU 22 IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG 95 SCOP domains d2abxa_ A: Bungarotoxin SCOP domains CATH domains 2abxA00 A:1-74 CD59 CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------SNAKE_TOXIN ----------- PROSITE Transcript -------------------------------------------------------------------------- Transcript 2abx A 1 IVCHTTATIPSSAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNHPPKRQPG 74 10 20 30 40 50 60 70 Chain B from PDB Type:PROTEIN Length:74 aligned with 3L21A_BUNMU | P60615 from UniProtKB/Swiss-Prot Length:95 Alignment length:74 31 41 51 61 71 81 91 3L21A_BUNMU 22 IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG 95 SCOP domains d2abxb_ B: Bungarotoxin SCOP domains CATH domains 2abxB00 B:1-74 CD59 CATH domains Pfam domains -------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------SNAKE_TOXIN ----------- PROSITE Transcript -------------------------------------------------------------------------- Transcript 2abx B 1 IVCHTTATIPSSAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNHPPKRQPG 74 10 20 30 40 50 60 70
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 2ABX) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (3L21A_BUNMU | P60615)
|
|
|
|
|
|
|