Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF MNEI, A SWEET PROTEIN
 
Authors :  P. A. Temussi, R. Spadaccini
Date :  12 Jul 00  (Deposition) - 16 Nov 00  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  5 Stranded Beta Sheet 1 Helix, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Spadaccini, O. Crescenzi, T. Tancredi, N. De Casamassimi, G. Saviano, R. Scognamiglio, A. Di Donato, P. A. Temussi
Solution Structure Of A Sweet Protein: Nmr Study Of Mnei, A Single Chain Monellin.
J. Mol. Biol. V. 305 505 2001
PubMed-ID: 11152608  |  Reference-DOI: 10.1006/JMBI.2000.4304
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MNEI SWEET PROTEIN RELATED TO MONELLIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-22B+
    Expression System Taxid562
    Expression System Vector TypePLASMID
    Organism CommonSERENDIPITY BERRY
    Organism ScientificDIOSCOREOPHYLLUM CUMMINSII
    Organism Taxid3457

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1FA3)

(-) Sites  (0, 0)

(no "Site" information available for 1FA3)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1FA3)

(-) Cis Peptide Bonds  (2, 40)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Arg A:39 -Pro A:40
21, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Gly A:91 -Pro A:92

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1FA3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1FA3)

(-) Exons   (0, 0)

(no "Exon" information available for 1FA3)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:96
 aligned with MONA_DIOCU | P02881 from UniProtKB/Swiss-Prot  Length:45

    Alignment length:96
                                                                               1                                            
                                     -         -         -         -         - |       9        19        29        39      
            MONA_DIOCU    - ---------------------------------------------------FREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP 45
               SCOP domains d1fa3a_ A: Monellin, B & A chains together                                                       SCOP domains
               CATH domains 1fa3A00 A:1-96  [code=3.10.450.10, no name defined]                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...ee...hhhhhhhhhhhhhhhhhhh......eeeeeeeeeeeeeee.....eeeeeeeeeeeee..eeeeeeeeee....eeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------ Transcript
                  1fa3 A  1 GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP 96
                                    10        20        30        40        50        60        70        80        90      

Chain A from PDB  Type:PROTEIN  Length:96
 aligned with MONB_DIOCU | P02882 from UniProtKB/Swiss-Prot  Length:50

    Alignment length:96
                                                                            50                                              
                                    10        20        30        40        50         -         -         -         -      
            MONB_DIOCU    1 GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEEN----------------------------------------------  -
               SCOP domains d1fa3a_ A: Monellin, B & A chains together                                                       SCOP domains
               CATH domains 1fa3A00 A:1-96  [code=3.10.450.10, no name defined]                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...ee...hhhhhhhhhhhhhhhhhhh......eeeeeeeeeeeeeee.....eeeeeeeeeeeee..eeeeeeeeee....eeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------ Transcript
                  1fa3 A  1 GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP 96
                                    10        20        30        40        50        60        70        80        90      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1FA3)

(-) Gene Ontology  (0, 0)

NMR Structure(hide GO term definitions)
    (no "Gene Ontology" information available for 1FA3)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1fa3)
 
  Sites
(no "Sites" information available for 1fa3)
 
  Cis Peptide Bonds
    Arg A:39 - Pro A:40   [ RasMol ]  
    Gly A:91 - Pro A:92   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1fa3
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MONA_DIOCU | P02881
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  MONB_DIOCU | P02882
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MONA_DIOCU | P02881
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MONB_DIOCU | P02882
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MONA_DIOCU | P028811fuw 1iv7 1iv9 1krl 1m9g 1mnl 2gpk 2o9u 3mon 3pxm 3pyj 3q2p 4mon 5lc6 5lc7
        MONB_DIOCU | P028821fuw 1iv7 1iv9 1krl 1m9g 1mnl 1mol 2o9u 3mon 3pxm 3pyj 3q2p 4mon 5lc6 5lc7

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1FA3)