Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  RELAXATION MATRIX REFINEMENT OF THE SOLUTION STRUCTURE OF THE ARC REPRESSOR
 
Authors :  A. M. J. J. Bonvin, H. Vis, M. J. M. Burgering, J. N. Breg, R. Boelens, R. Kaptein
Date :  24 Aug 93  (Deposition) - 31 Jan 94  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (16x)
Keywords :  Gene-Regulating Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. M. Bonvin, H. Vis, J. N. Breg, M. J. Burgering, R. Boelens, R. Kaptein
Nuclear Magnetic Resonance Solution Structure Of The Arc Repressor Using Relaxation Matrix Calculations.
J. Mol. Biol. V. 236 328 1994
PubMed-ID: 8107113  |  Reference-DOI: 10.1006/JMBI.1994.1138
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ARC REPRESSOR
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificENTEROBACTERIA PHAGE P22
    Organism Taxid10754

 Structural Features

(-) Chains, Units

  
NMR Structure (16x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1ARQ)

(-) Sites  (0, 0)

(no "Site" information available for 1ARQ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1ARQ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1ARQ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1ARQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1ARQ)

(-) Exons   (0, 0)

(no "Exon" information available for 1ARQ)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:53
 aligned with RARC_BPP22 | P03050 from UniProtKB/Swiss-Prot  Length:53

    Alignment length:53
                                    10        20        30        40        50   
            RARC_BPP22    1 MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA 53
               SCOP domains d1arqa_ A: Arc repressor                              SCOP domains
               CATH domains 1arqA00 A:1-53 Met repressor-like                     CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeee.hhhhhhhhhhhhhh.....hhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------- Transcript
                  1arq A  1 MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA 53
                                    10        20        30        40        50   

Chain B from PDB  Type:PROTEIN  Length:53
 aligned with RARC_BPP22 | P03050 from UniProtKB/Swiss-Prot  Length:53

    Alignment length:53
                                    10        20        30        40        50   
            RARC_BPP22    1 MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA 53
               SCOP domains d1arqb_ B: Arc repressor                              SCOP domains
               CATH domains 1arqB00 B:1-53 Met repressor-like                     CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeee.hhhhhhhhhhhhhh.....hhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------- Transcript
                  1arq B  1 MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA 53
                                    10        20        30        40        50   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure

(-) CATH Domains  (1, 2)

NMR Structure

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1ARQ)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A,B   (RARC_BPP22 | P03050)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1arq)
 
  Sites
(no "Sites" information available for 1arq)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1arq)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1arq
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RARC_BPP22 | P03050
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RARC_BPP22 | P03050
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RARC_BPP22 | P030501arr 1b28 1baz 1bdt 1bdv 1myk 1myl 1nla 1par 1qtg 1u9p

(-) Related Entries Specified in the PDB File

1arr