|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1QTG) |
Sites (0, 0)| (no "Site" information available for 1QTG) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1QTG) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1QTG) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1QTG) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1QTG) |
Exons (0, 0)| (no "Exon" information available for 1QTG) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:53 aligned with RARC_BPP22 | P03050 from UniProtKB/Swiss-Prot Length:53 Alignment length:53 10 20 30 40 50 RARC_BPP22 1 MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA 53 SCOP domains d1qtga_ A: Arc repressor SCOP domains CATH domains 1qtgA00 A:1-53 Met repressor-like CATH domains Pfam domains ----------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------- PROSITE Transcript ----------------------------------------------------- Transcript 1qtg A 1 MKGMSKMPQFLNRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA 53 10 20 30 40 50 Chain B from PDB Type:PROTEIN Length:53 aligned with RARC_BPP22 | P03050 from UniProtKB/Swiss-Prot Length:53 Alignment length:53 10 20 30 40 50 RARC_BPP22 1 MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA 53 SCOP domains d1qtgb_ B: Arc repressor SCOP domains CATH domains 1qtgB00 B:1-53 Met repressor-like CATH domains Pfam domains (1) ---Arc-1qtgB01 B:4-53 Pfam domains (1) Pfam domains (2) ---Arc-1qtgB02 B:4-53 Pfam domains (2) SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------- PROSITE Transcript ----------------------------------------------------- Transcript 1qtg B 1 MKGMSKMPQFLNRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA 53 10 20 30 40 50
|
||||||||||||||||||||
SCOP Domains (1, 2)| NMR Structure |
CATH Domains (1, 2)
NMR Structure
|
Pfam Domains (1, 2)| NMR Structure |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A,B (RARC_BPP22 | P03050)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|