Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE, FOLDING, AND OPERATOR BINDING OF THE HYPERSTABLE ARC REPRESSOR MUTANT PL8
 
Authors :  J. F. Schildbach, M. E. Milla, P. D. Jeffrey, B. E. Raumann, R. T. Sauer
Date :  12 Oct 94  (Deposition) - 26 Jan 95  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Transcription Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. F. Schildbach, M. E. Milla, P. D. Jeffrey, B. E. Raumann, R. T. Sauer
Crystal Structure, Folding, And Operator Binding Of The Hyperstable Arc Repressor Mutant Pl8.
Biochemistry V. 34 1405 1995
PubMed-ID: 7827088  |  Reference-DOI: 10.1021/BI00004A035
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ARC REPRESSOR
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PTA200-PL8
    Expression System Taxid: 562
    Gene: MUTATED ARC GENE
    Organism Scientific: ENTEROBACTERIA PHAGE P22
    Organism Taxid: 10754

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1MYK)

(-) Sites  (0, 0)

(no "Site" information available for 1MYK)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1MYK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1MYK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1MYK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1MYK)

(-) Exons   (0, 0)

(no "Exon" information available for 1MYK)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:47
 aligned with RARC_BPP22 | P03050 from UniProtKB/Swiss-Prot  Length:53

    Alignment length:47
                                    15        25        35        45       
            RARC_BPP22    6 KMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIG 52
               SCOP domains d1myka_ A: Arc repressor                        SCOP domains
               CATH domains 1mykA00 A:6-52 Met repressor-like               CATH domains
               Pfam domains ----------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeehhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------- PROSITE
                 Transcript ----------------------------------------------- Transcript
                  1myk A  6 KMLQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIG 52
                                    15        25        35        45       


Chain B from PDB  Type:PROTEIN  Length:45
 aligned with RARC_BPP22 | P03050 from UniProtKB/Swiss-Prot  Length:53

    Alignment length:45
                                    15        25        35        45     
            RARC_BPP22    6 KMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGR 50
               SCOP domains d1mykb_ B: Arc repressor                      SCOP domains
               CATH domains 1mykB00 B:6-50 Met repressor-like             CATH domains
           Pfam domains (1) Arc-1mykB01 B:6-50                            Pfam domains (1)
           Pfam domains (2) Arc-1mykB02 B:6-50                            Pfam domains (2)
         Sec.struct. author .eeeeeeeeehhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------- PROSITE
                 Transcript --------------------------------------------- Transcript
                  1myk B  6 KMLQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGR 50
                                    15        25        35        45
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: Met_repress (26)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (RARC_BPP22 | P03050)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1myk)
 
  Sites
(no "Sites" information available for 1myk)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1myk)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1myk
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RARC_BPP22 | P03050
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  RARC_BPP22 | P03050
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RARC_BPP22 | P03050: 1arq 1arr 1b28 1baz 1bdt 1bdv 1myl 1nla 1par 1qtg 1u9p

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1MYK)