|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1NLA) |
(no "Site" information available for 1NLA) |
(no "SS Bond" information available for 1NLA) |
(no "Cis Peptide Bond" information available for 1NLA) |
(no "SAP(SNP)/Variant" information available for 1NLA) |
(no "PROSITE Motif" information available for 1NLA) |
(no "Exon" information available for 1NLA) |
NMR StructureChain A from PDB Type:PROTEIN Length:53 aligned with RARC_BPP22 | P03050 from UniProtKB/Swiss-Prot Length:53 Alignment length:53 10 20 30 40 50 RARC_BPP22 1 MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA 53 SCOP domains d1nlaa_ A: Arc repressor SCOP domains CATH domains 1nlaA00 A:1-53 Met repressor-like CATH domains Pfam domains ----------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------- PROSITE Transcript ----------------------------------------------------- Transcript 1nla A 1 MKGMSKMPQFLNRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA 53 10 20 30 40 50 Chain B from PDB Type:PROTEIN Length:53 aligned with RARC_BPP22 | P03050 from UniProtKB/Swiss-Prot Length:53 Alignment length:53 10 20 30 40 50 RARC_BPP22 1 MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA 53 SCOP domains d1nlab_ B: Arc repressor SCOP domains CATH domains 1nlaB00 B:1-53 Met repressor-like CATH domains Pfam domains (1) ---Arc-1nlaB01 B:4-53 Pfam domains (1) Pfam domains (2) ---Arc-1nlaB02 B:4-53 Pfam domains (2) SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------- PROSITE Transcript ----------------------------------------------------- Transcript 1nla B 1 MKGMSKMPQFLNRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA 53 10 20 30 40 50
|
NMR Structure |
NMR Structure
|
NMR Structure |
NMR Structure(hide GO term definitions) Chain A,B (RARC_BPP22 | P03050)
|
|
|
|
|
|
|