Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF A PHOSPHATIDYLINOSITOLPHOSPHATE (PIP) SYNTHASE FROM RENIBACTERIUM SALMONINARUM
 
Authors :  O. B. Clarke, D. T. Tomasek, C. D. Jorge, M. Belcher Dufrisne, M. Kim, S. K. R. Rajashankar, W. A. Hendrickson, H. Santos, F. Mancia
Date :  18 Aug 15  (Deposition) - 11 Nov 15  (Release) - 11 Nov 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A
Keywords :  Membrane Protein, Enzyme, Lipid Biosynthesis, Phosphatidylinositol (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  O. B. Clarke, D. Tomasek, C. D. Jorge, M. B. Dufrisne, M. Kim, S. Banerjee, K. R. Rajashankar, L. Shapiro, W. A. Hendrickson, H. Santos, F. Mancia
Structural Basis For Phosphatidylinositol-Phosphate Biosynthesis.
Nat Commun V. 6 8505 2015
PubMed-ID: 26510127  |  Reference-DOI: 10.1038/NCOMMS9505

(-) Compounds

Molecule 1 - AF2299 PROTEIN,PHOSPHATIDYLINOSITOL SYNTHASE
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: AF_2299, RSAL33209_2010
    Organism Scientific: ARCHAEOGLOBUS FULGIDUS, RENIBACTERIUM SALMONINARUM
    Organism Taxid: 224325, 288705
    Strain: ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126, ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 40)

Asymmetric/Biological Unit (3, 40)
No.NameCountTypeFull Name
18K635Ligand/IonOCTADECANE
2MG1Ligand/IonMAGNESIUM ION
3SO44Ligand/IonSULFATE ION

(-) Sites  (32, 32)

Asymmetric Unit (32, 32)
No.NameEvidenceResiduesDescription
01AC1SOFTWARESER A:130 , LYS A:133 , ARG A:153 , ARG A:191binding site for residue SO4 A 301
02AC2SOFTWAREPRO A:169 , SER A:170 , HOH A:404binding site for residue SO4 A 302
03AC3SOFTWAREGLN A:51binding site for residue 8K6 A 303
04AC4SOFTWAREASP A:29 , ARG A:196 , 8K6 A:332binding site for residue 8K6 A 304
05AC5SOFTWARETHR A:114 , ILE A:117 , 8K6 A:316binding site for residue 8K6 A 305
06AC6SOFTWAREASP A:66 , ASP A:87 , ASP A:91binding site for residue MG A 307
07AC7SOFTWARETRP A:24 , 8K6 A:314binding site for residue 8K6 A 310
08AC8SOFTWARE8K6 A:328binding site for residue 8K6 A 312
09AC9SOFTWAREPHE A:189binding site for residue 8K6 A 313
10AD1SOFTWAREGLY A:25 , SER A:27 , 8K6 A:310 , 8K6 A:327binding site for residue 8K6 A 314
11AD2SOFTWARE8K6 A:324binding site for residue 8K6 A 315
12AD3SOFTWARELEU A:20 , 8K6 A:305binding site for residue 8K6 A 316
13AD4SOFTWARE8K6 A:318binding site for residue 8K6 A 317
14AD5SOFTWARE8K6 A:317binding site for residue 8K6 A 318
15AD6SOFTWARELEU A:9binding site for residue 8K6 A 319
16AD7SOFTWARE8K6 A:325binding site for residue 8K6 A 320
17AD8SOFTWARELEU A:20 , 8K6 A:322 , HOH A:434binding site for residue 8K6 A 321
18AD9SOFTWAREILE A:13 , PRO A:16 , 8K6 A:321 , 8K6 A:333binding site for residue 8K6 A 322
19AE1SOFTWAREVAL A:63 , VAL A:155 , VAL A:159 , 8K6 A:315binding site for residue 8K6 A 324
20AE2SOFTWARE8K6 A:320binding site for residue 8K6 A 325
21AE3SOFTWARESER A:65 , 8K6 A:314binding site for residue 8K6 A 327
22AE4SOFTWARETRP A:54 , 8K6 A:312binding site for residue 8K6 A 328
23AE5SOFTWAREARG A:78 , GLY A:80 , TRP A:82 , GLY A:83 , HOH A:407binding site for residue SO4 A 329
24AE6SOFTWAREARG A:7binding site for residue SO4 A 330
25AE7SOFTWARE8K6 A:337binding site for residue 8K6 A 331
26AE8SOFTWARESER A:27 , ALA A:30 , ARG A:78 , 8K6 A:304binding site for residue 8K6 A 332
27AE9SOFTWARE8K6 A:322binding site for residue 8K6 A 333
28AF1SOFTWARELEU A:44 , PRO A:48 , 8K6 A:335binding site for residue 8K6 A 334
29AF2SOFTWAREILE A:117 , 8K6 A:334binding site for residue 8K6 A 335
30AF3SOFTWARE8K6 A:331 , 8K6 A:340binding site for residue 8K6 A 337
31AF4SOFTWAREALA A:12binding site for residue 8K6 A 338
32AF5SOFTWARETRP A:24 , 8K6 A:337binding site for residue 8K6 A 340

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5D91)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5D91)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5D91)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5D91)

(-) Exons   (0, 0)

(no "Exon" information available for 5D91)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:335
                                                                                                                                                                                                                                                                                                                                                                                
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..hhhh.ee..eehhhhhhhhhhhh..eeeee..........eeee...eee..........eeeee..eeeeeeehhhhhhh...hhhhhhhhhhhhh...eee..eee....hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5d91 A -130 MRLAYVKNHEIYGEKLLGLTLRERIEKTLQRAGFDVRFFDELSLEEAEDYLIILEPVLILERDLLLEGRKILVSDGFTVGYFFGGDFRTVFDGNLQSSIEKYLSLNNLESYEIWAIKLSNDNLKTAEKLLLSSLIGSRGLFAAIFLPIARLLADWGVSPDAVTVVGTLGVMAGALIFYPMGQLFWGTVVITVFVFSDIIDGLMARLLFREGPWGAFLDSYLDRVGDSSVFTGIVIWFFLGGANPTIAILALICLVLSSLVSYSKARAEGLGLTANVGIAERSERLVVVLVATGLVGLGIPSWVLLVVLIVLAIASVVTIFQRVLTVREQAKAWTA  204
                                  -121      -111      -101       -91       -81       -71       -61       -51       -41       -31       -21       -11        -1         9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5D91)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5D91)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5D91)

(-) Gene Ontology  (7, 12)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    8K6  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5d91)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5d91
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A9WSF5_RENSM | A9WSF5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  O27985_ARCFU | O27985
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A9WSF5_RENSM | A9WSF5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  O27985_ARCFU | O27985
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        A9WSF5_RENSM | A9WSF5: 5d92
        O27985_ARCFU | O27985: 4o6m 4o6n 4q7c 5d92

(-) Related Entries Specified in the PDB File

5d92