Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN ADENOVIRUS 2 PROTEASE A SUBSTRATE BASED NITRILE INHIBITOR
 
Authors :  A. Mac Sweeney, P. Grosche, D. Ellis, C. Combrink, C. Erbel, N. Hughes, F. Sirockin, S. Melkko, A. Bernardi, P. Ramage, N. Jarousse, E. Altman
Date :  08 May 14  (Deposition) - 10 Sep 14  (Release) - 10 Sep 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.94
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Adenain, Adenovirus, Cofactor, Pvic, Cysteine Protease, Hydrolase- Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Mac Sweeney, P. Grosche, D. Ellis, K. Combrink, P. Erbel, N. Hughes F. Sirockin, S. Melkko, A. Bernardi, P. Ramage, N. Jarousse, E. Altman
Discovery And Structure-Based Optimization Of Adenain Inhibitors.
Acs Med. Chem. Lett. V. 5 937 2014
PubMed-ID: 25147618  |  Reference-DOI: 10.1021/ML500224T

(-) Compounds

Molecule 1 - PROTEASE
    Chains: A
    EC Number: 3.4.22.39
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: L3
    Organism Common: HADV-2
    Organism Scientific: HUMAN ADENOVIRUS 2
    Organism Taxid: 10515
    Synonym: ADENAIN,ADENOVIRUS PROTEASE,AVP,ADENOVIRUS PROTEINASE, ENDOPROTEASE
 
Molecule 2 - PRE-PROTEIN VI
    Chains: B
    Engineered: YES
    Fragment: UNP RESIDUES 240-250
    Organism Common: HADV-2
    Organism Scientific: HUMAN ADENOVIRUS 2
    Organism Taxid: 10515
    Synonym: PVI
    Synthetic: YES

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 5)

Asymmetric/Biological Unit (4, 5)
No.NameCountTypeFull Name
13FO1Ligand/IonN-{(2S)-2-(3-CHLOROPHENYL)-2-[(METHYLSULFONYL)AMINO]ACETYL}-L-PHENYLALANYL-N-[(2Z)-2-IMINOETHYL]GLYCINAMIDE
2ACT1Ligand/IonACETATE ION
3SO42Ligand/IonSULFATE ION
4ZN1Ligand/IonZINC ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:2 , SER A:3 , SER A:4 , GLU A:5 , GLN A:6 , ASP A:26 , ASN A:44 , ALA A:46 , GLY A:47 , ARG A:48 , GLY A:51 , GLY A:52 , VAL A:53 , TRP A:55 , GLN A:115 , SER A:119 , CYS A:122 , ARG A:186binding site for residue 3FO A 301
2AC2SOFTWARESER A:76 , ASP A:77 , LYS A:109 , ARG B:306binding site for residue SO4 A 302
3AC3SOFTWAREPHE A:73 , TYR A:84 , PRO A:117 , PRO A:165binding site for residue SO4 A 303
4AC4SOFTWAREHIS A:36 , CYS A:199 , ACT A:305 , HOH A:405binding site for residue ZN A 304
5AC5SOFTWAREPRO A:35 , HIS A:36 , GLN A:82 , ZN A:304 , HOH A:401binding site for residue ACT A 305

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:104 -B:309

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4PIE)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4PIE)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4PIE)

(-) Exons   (0, 0)

(no "Exon" information available for 4PIE)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:202
                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh.hhh.eeeee.............eeeeee..hhhhh...eeeeeee....eeeee.....hhhhhhhhhh..hhhhhhhhhhhhh...eeeeeee.ee.......hhhhhhhhhhhhhhhh.........hhhhh..ee.hhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4pie A   2 GSSEQELKAIVKDLGCGPYFLGTYDKRFPGFVSPHKLACAIVNTAGRETGGVHWMAFAWNPRSKTCYLFEPFGFSDQRLKQVYQFEYESLLRRSAIASSPDRCITLEKSTQSVQGPNSAACGLFCCMFLHAFANWPQTPMDHNPTMNLITGVPNSMLNSPQVQPTLRRNQEQLYSFLERHSPYFRSHSAQIRSATSFCHLKN 203
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201  


Chain B from PDB  Type:PROTEIN  Length:11
                                           
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author ...eeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------- SAPs(SNPs)
                    PROSITE ----------- PROSITE
                 Transcript ----------- Transcript
                 4pie B 300 GVQSLKRRRCF 310
                                   309
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4PIE)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4PIE)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4PIE)

(-) Gene Ontology  (17, 19)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    3FO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4pie)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4pie
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CAP6_ADE02 | P03274
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PRO_ADE02 | P03252
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.22.39
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CAP6_ADE02 | P03274
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PRO_ADE02 | P03252
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CAP6_ADE02 | P03274: 1avp 1nln 4pid 5fgy
        PRO_ADE02 | P03252: 1avp 1nln 4ekf 4pid 5fgy

(-) Related Entries Specified in the PDB File

4piq 4pis