4DEN - JenaLib

Title :   STRUCTURAL INSIGHTSINTO POTENT, SPECIFIC ANTI-HIV PROPERTY OF ACTINOHIVIN; CRYSTAL STRUCTURE OF ACTINOHIVIN IN COMPLEX WITH ALPHA(1-2) MANNOBIOSE MOIETY OF HIGH-MANNOSE TYPE GLYCAN OF GP120

Authors :   M. M. Hoque, K. Suzuki, M. Tsunoda, J. Jiang, F. Zhang, A. Takahashi, O. N X. Zhang, T. Sekiguchi, H. Tanaka, S. Omura, A. Takenaka

Date :   20 Jan 12 (Deposition) - 28 Nov 12 (Release) - 28 Nov 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.60

Chains :   Asym./Biol. Unit : A

Keywords :   Anti-Hiv Lectin, Molecular Recognition, High-Mannose Type Glycan, Antiviral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. M. Hoque, K. Suzuki, M. Tsunoda, J. Jiang, F. Zhang, A. Takahashi, N. Ohbayashi, X. Zhang, H. Tanaka, S. Omura, A. Takenaka
Structural Insights Into The Specific Anti-Hiv Property Of Actinohivin: Structure Of Its Complex With The Alpha(1– 2)Mannobiose Moiety Of Gp120
Acta Crystallogr. , Sect. D V. 68 1671 2012
PubMed-ID: 23151632 | Reference-DOI: 10.1107/S0907444912040498

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 6)

Sites (6, 6)

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:61 , TYR A:69 , LEU A:71 , ASN A:74 , GLY A:75 , GLY A:76 , ASN A:77 , TYR A:78 , ASP A:99 , SER A:100 , TYR A:107 , ASN A:112 , GLY A:114 , SER A:115 , TYR A:116 , GLN A:117 , LYS A:118 , ASP A:137 , SER A:138 , TYR A:145 , LEU A:147 , ASN A:150 , GLY A:151 , GLY A:152 , ASN A:153 , TYR A:154 , LYS A:156 , 2M4 A:202 , 2M4 A:203 , K A:204 , K A:205 , K A:206 , HOH A:310 , HOH A:340 , HOH A:364	BINDING SITE FOR RESIDUE 2M4 A 201
2	AC2	SOFTWARE	GLN A:55 , ASP A:61 , SER A:62 , ASN A:63 , TYR A:69 , LEU A:71 , ASN A:74 , GLY A:75 , GLY A:76 , ASN A:77 , TYR A:78 , ASP A:99 , SER A:100 , ASN A:101 , TYR A:107 , ASN A:112 , GLY A:113 , GLY A:114 , SER A:115 , TYR A:116 , GLN A:117 , LYS A:118 , ASP A:137 , SER A:138 , ASN A:139 , TYR A:145 , ASN A:150 , GLY A:151 , GLY A:152 , ASN A:153 , TYR A:154 , LYS A:156 , 2M4 A:201 , 2M4 A:203 , K A:204 , K A:205 , K A:206 , HOH A:310 , HOH A:340 , HOH A:364	BINDING SITE FOR RESIDUE 2M4 A 202
3	AC3	SOFTWARE	GLN A:55 , ASP A:61 , TYR A:69 , LEU A:71 , ASN A:74 , GLY A:75 , GLY A:76 , ASN A:77 , TYR A:78 , ASP A:99 , SER A:100 , TYR A:107 , ASN A:112 , GLY A:113 , GLY A:114 , SER A:115 , TYR A:116 , GLN A:117 , LYS A:118 , ASP A:137 , SER A:138 , TYR A:145 , LEU A:147 , ASN A:150 , GLY A:151 , GLY A:152 , ASN A:153 , TYR A:154 , LYS A:156 , 2M4 A:201 , 2M4 A:202 , K A:204 , K A:205 , K A:206 , HOH A:310 , HOH A:340 , HOH A:364	BINDING SITE FOR RESIDUE 2M4 A 203
4	AC4	SOFTWARE	ASN A:74 , ASN A:112 , ASN A:150 , 2M4 A:201 , 2M4 A:202 , 2M4 A:203	BINDING SITE FOR RESIDUE K A 204
5	AC5	SOFTWARE	2M4 A:201 , 2M4 A:202 , 2M4 A:203 , HOH A:315	BINDING SITE FOR RESIDUE K A 205
6	AC6	SOFTWARE	ASN A:63 , TYR A:64 , ASN A:101 , TYR A:102 , TYR A:116 , TYR A:140 , TYR A:154 , 2M4 A:201 , 2M4 A:202 , 2M4 A:203	BINDING SITE FOR RESIDUE K A 206

SS Bonds (1, 1)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:112
 aligned with AHV_ACTSK | Q9KWN0 from UniProtKB/Swiss-Prot  Length:160

    Alignment length:112
                                    58        68        78        88        98       108       118       128       138       148       158  
            AHV_ACTSK    49 VTIRNAQTGRLLDSNYNGNVYTLPANGGNYQRWTGPGDGTVRNAQTGRCLDSNYDGAVYTLPCNGGSYQKWLFYSNGYIQNVETGRVLDSNYNGNVYTLPANGGNYQKWYTG 160
               SCOP domains ---------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee.....eeee.....eeee....hhhh.ee.......ee.....eeee.....eeee....hhhh.eee.....eee.....eeee.....eeee....hhhh.eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------- Transcript
                 4den A  49 VTIRNAQTGRLLDSNYNGNVYTLPANGGNYQRWTGPGDGTVRNAQTGRCLDSNYDGAVYTLPCNGGSYQKWLFYSNGYIQNVETGRVLDSNYNGNVYTLPANGGNYQKWYTG 160
                                    58        68        78        88        98       108       118       128       138       148       158

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (AHV_ACTSK | Q9KWN0)

molecular function
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0050688	regulation of defense response to virus	Any process that modulates the frequency, rate or extent of the antiviral response of a cell or organism.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		2M4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		K	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4den)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	4den
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AHV_ACTSK \| Q9KWN0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AHV_ACTSK \| Q9KWN0
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description