4P6A - JenaLib

Title :   CRYSTAL STRUCTURE OF A POTENT ANTI-HIV LECTIN ACTINOHIVIN IN COMPLEX WITH ALPHA-1,2-MANNOTRIOSE

Authors :   F. Zhang, M. M. Hoque, K. Suzuki, M. Tsunoda, O. Naomi, H. Tanaka, A. Take

Date :   23 Mar 14 (Deposition) - 04 Mar 15 (Release) - 04 Mar 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.40

Chains :   Asym./Biol. Unit : A

Keywords :   Actinohivin, Anti-Hiv Lectin, High-Mannose Type Glycan (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   F. Zhang, M. M. Hoque, J. Jiang, K. Suzuki, M. Tsunoda, Y. Takeda, Y. Ito G. Kawai, H. Tanaka, A. Takenaka
The Characteristic Structure Of Anti-Hiv Actinohivin In Complex With Three Hmtg D1 Chains Of Hiv-Gp120.
Chembiochem V. 15 2766 2014
PubMed-ID: 25403811 | Reference-DOI: 10.1002/CBIC.201402352

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 9)

Sites (3, 3)

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:15 , SER A:16 , ASN A:17 , TYR A:23 , ASN A:28 , GLY A:30 , TYR A:32 , HOH A:305 , HOH A:314 , HOH A:411 , HOH A:433 , HOH A:451 , HOH A:459 , HOH A:461 , HOH A:467	binding site for Poly-Saccharide residues MAN A 201 through MAN A 203
2	AC2	SOFTWARE	ASP A:15 , SER A:16 , TYR A:23 , ASN A:28 , GLY A:30 , TYR A:32 , ASP A:53 , SER A:54 , TYR A:61 , ASN A:66 , GLY A:68 , TYR A:70 , MAN A:201 , HOH A:303 , HOH A:307 , HOH A:314 , HOH A:357 , HOH A:407 , HOH A:411 , HOH A:433 , HOH A:449 , HOH A:450 , HOH A:451 , HOH A:459 , HOH A:461 , HOH A:467	binding site for Poly-Saccharide residues MAN A 204 through MAN A 206
3	AC3	SOFTWARE	ASP A:53 , SER A:54 , TYR A:61 , ASN A:66 , GLY A:68 , ASP A:91 , SER A:92 , TYR A:99 , ASN A:104 , GLY A:106 , TYR A:108 , MAN A:204 , HOH A:302 , HOH A:303 , HOH A:306 , HOH A:307 , HOH A:311 , HOH A:330 , HOH A:348 , HOH A:357 , HOH A:407 , HOH A:417 , HOH A:445 , HOH A:446 , HOH A:449 , HOH A:450 , HOH A:466	binding site for Poly-Saccharide residues MAN A 207 through MAN A 209

SS Bonds (1, 1)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:114
                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eee.....eeee.....eeee....hhhh.ee.......ee.....eeee.....eeee....hhhh.eee.....eee.....eeee.....eeee....hhhh.eee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 4p6a A   1 ASVTIRNAQTGRLLDSNYNGNVYTLPANGGNYQRWTGPGDGTVRNAQTGRCLDSNYDGAVYTLPCNGGSYQKWLFYSNGYIQNVETGRVLDSNYNGNVYTLPANGGNYQKWYTG 114
                                    10        20        30        40        50        60        70        80        90       100       110

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (3, 3)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MAN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4p6a)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	4p6a
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AHV_ACTSK \| Q9KWN0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AHV_ACTSK \| Q9KWN0
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description