Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF CREN7 MUTANT L28M IN COMPLEX WITH DSDNA
 
Authors :  Z. F. Zhang, M. H. Zhao, L. Wang, Y. Y. Chen, Y. H. Dong, Y. Gong, L. Huang
Date :  31 Dec 16  (Deposition) - 26 Apr 17  (Release) - 24 May 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,C,D  (1x)
Biol. Unit 2:  B,E,F  (1x)
Keywords :  Beta-Sheet, Dna Binding, Dna Binding Protein-Dna Complex, Crenarchaeal Chromatin Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Z. Zhang, M. Zhao, L. Wang, Y. Chen, Y. Dong, Y. Gong, L. Huang
Roles Of Leu28 Side Chain Intercalation In The Interaction Between Cren7 And Dna
Biochem. J. V. 474 1727 2017
PubMed-ID: 28377493  |  Reference-DOI: 10.1042/BCJ20170036

(-) Compounds

Molecule 1 - CHROMATIN PROTEIN CREN7
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET30A
    Expression System StrainROSETTA 2 (DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneCREN7, SSO6901
    MutationYES
    Organism ScientificSULFOLOBUS SOLFATARICUS (STRAIN ATCC 35092 / DSM 1617 / JCM 11322 / P2)
    Organism Taxid273057
    StrainATCC 35092 / DSM 1617 / JCM 11322 / P2
 
Molecule 2 - DNA (5'-D(*GP*TP*AP*AP*TP*TP*AP*C)-3')
    ChainsC, D, E, F
    EngineeredYES
    Organism ScientificSYNTHETIC CONSTRUCT
    Organism Taxid32630
    SyntheticYES

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDEF
Biological Unit 1 (1x)A CD  
Biological Unit 2 (1x) B  EF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5WWC)

(-) Sites  (0, 0)

(no "Site" information available for 5WWC)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5WWC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5WWC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5WWC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5WWC)

(-) Exons   (0, 0)

(no "Exon" information available for 5WWC)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:56
                                                                                        
               SCOP domains -------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....eeee...eeeee.......eeeeeee......eeeee....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------- Transcript
                 5wwc A   5 KKPVKVKTPAGKEAELVPEKVWAMAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI  60
                                    14        24        34        44        54      

Chain B from PDB  Type:PROTEIN  Length:59
                                                                                           
               SCOP domains ----------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.....eeee...eeeee.......eeeeeee......eeeee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------- Transcript
                 5wwc B   2 SSGKKPVKVKTPAGKEAELVPEKVWAMAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI  60
                                    11        21        31        41        51         

Chain C from PDB  Type:DNA  Length:8
                                        
                 5wwc C 101 GTAATTAC 108

Chain D from PDB  Type:DNA  Length:8
                                        
                 5wwc D 109 GTAATTAC 116

Chain E from PDB  Type:DNA  Length:8
                                        
                 5wwc E 101 GTAATTAC 108

Chain F from PDB  Type:DNA  Length:8
                                        
                 5wwc F 109 GTAATTAC 116

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5WWC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5WWC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5WWC)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5wwc)
 
  Sites
(no "Sites" information available for 5wwc)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5wwc)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5wwc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CREN7_SULSO | Q97ZE3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CREN7_SULSO | Q97ZE3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CREN7_SULSO | Q97ZE32jtm 3kxt 3lwh 3lwi 4r55 4r56 5k07 5k17 5wvw 5wvy 5wvz

(-) Related Entries Specified in the PDB File

5wvw 5wvy 5wvz