Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF CREN7 MUTANT L28F IN COMPLEX WITH DSDNA
 
Authors :  Z. F. Zhang, M. H. Zhao, L. Wang, Y. Y. Chen, Y. H. Dong, Y. Gong, L. Huang
Date :  30 Dec 16  (Deposition) - 26 Apr 17  (Release) - 24 May 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,C,D  (1x)
Biol. Unit 2:  B,E,F  (1x)
Keywords :  Beta-Sheet, Dna Binding, Dna Binding Protein-Dna Complex, Crenarchaeal Chromatin Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Z. Zhang, M. Zhao, L. Wang, Y. Chen, Y. Dong, Y. Gong, L. Huang
Roles Of Leu28 Side Chain Intercalation In The Interaction Between Cren7 And Dna
Biochem. J. V. 474 1727 2017
PubMed-ID: 28377493  |  Reference-DOI: 10.1042/BCJ20170036

(-) Compounds

Molecule 1 - CHROMATIN PROTEIN CREN7
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET30A
    Expression System Strain: ROSETTA 2 (DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: CREN7, SSO6901
    Mutation: YES
    Organism Scientific: SULFOLOBUS SOLFATARICUS (STRAIN ATCC 35092 / DSM 1617 / JCM 11322 / P2)
    Organism Taxid: 273057
    Strain: ATCC 35092 / DSM 1617 / JCM 11322 / P2
 
Molecule 2 - DNA (5'-D(*GP*CP*GP*AP*TP*CP*GP*C)-3')
    Chains: C, D, E, F
    Engineered: YES
    Organism Scientific: SYNTHETIC CONSTRUCT
    Organism Taxid: 32630
    Synthetic: YES

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEF
Biological Unit 1 (1x): A CD  
Biological Unit 2 (1x):  B  EF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5WVZ)

(-) Sites  (0, 0)

(no "Site" information available for 5WVZ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5WVZ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5WVZ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5WVZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5WVZ)

(-) Exons   (0, 0)

(no "Exon" information available for 5WVZ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:59
                                                                                           
               SCOP domains ----------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.....eeee...eeeee.......eeeeeee......eeeee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------- Transcript
                 5wvz A   2 SSGKKPVKVKTPAGKEAELVPEKVWAFAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI  60
                                    11        21        31        41        51         


Chain B from PDB  Type:PROTEIN  Length:59
                                                                                           
               SCOP domains ----------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.....eeee...eeeee.......eeeeeee......eeeee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------- Transcript
                 5wvz B   2 SSGKKPVKVKTPAGKEAELVPEKVWAFAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI  60
                                    11        21        31        41        51         


Chain C from PDB  Type:DNA  Length:8
                                        
                 5wvz C 101 GCGATCGC 108


Chain D from PDB  Type:DNA  Length:8
                                        
                 5wvz D 109 GCGATCGC 116


Chain E from PDB  Type:DNA  Length:8
                                        
                 5wvz E 101 GCGATCGC 108


Chain F from PDB  Type:DNA  Length:8
                                        
                 5wvz F 109 GCGATCGC 116
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5WVZ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5WVZ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5WVZ)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5wvz)
 
  Sites
(no "Sites" information available for 5wvz)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5wvz)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5wvz
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CREN7_SULSO | Q97ZE3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CREN7_SULSO | Q97ZE3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CREN7_SULSO | Q97ZE3: 2jtm 3kxt 3lwh 3lwi 4r55 4r56 5k07 5k17 5wvw 5wvy 5wwc

(-) Related Entries Specified in the PDB File

5wvw 5wvy 5wwc