Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)

(-) Description

Title :  NEUROSPORA CRASSA POLYSACCHARIDE MONOOXYGENASE 2 HIGH MANNOSYLATION
 
Authors :  W. B. O'Dell, F. Meilleur
Date :  06 Oct 16  (Deposition) - 17 May 17  (Release) - 17 May 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  A,B  (1x)
Biol. Unit 6:  C (1x),D (1x)
Keywords :  Oxidoreductase, Polysaccharide Monooxygenase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  W. B. O'Dell, P. D. Swartz, K. L. Weiss, F. Meilleur
Crystallization Of A Fungal Lytic Polysaccharide Monooxygenase Expressed From Glycoengineered Pichia Pastori For X-Ray And Neutron Diffraction.
Acta Crystallogr F Struct V. 73 70 2017 Biol Commun
PubMed-ID: 28177316  |  Reference-DOI: 10.1107/S2053230X16020318

(-) Compounds

Molecule 1 - LYTIC POLYSACCHARIDE MONOOXYGENASE
    Chains: A, B, C, D
    Engineered: YES
    Expression System: PICHIA PASTORIS
    Expression System Plasmid: PPICZALPHAA
    Expression System Strain: X-33
    Expression System Taxid: 4922
    Expression System Vector Type: PLASMID
    Gene: G15G9.090, GE21DRAFT_7469
    Organism Scientific: NEUROSPORA CRASSA
    Organism Taxid: 5141
    Synonym: RELATED TO CEL1 PROTEIN

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A   
Biological Unit 2 (1x):  B  
Biological Unit 3 (1x):   C 
Biological Unit 4 (1x):    D
Biological Unit 5 (1x): AB  
Biological Unit 6 (1x):   C (1x)D (1x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 20)

Asymmetric Unit (4, 20)
No.NameCountTypeFull Name
1CU4Ligand/IonCOPPER (II) ION
2MAN7Ligand/IonALPHA-D-MANNOSE
3NAG7Ligand/IonN-ACETYL-D-GLUCOSAMINE
4OXY2Ligand/IonOXYGEN MOLECULE
Biological Unit 1 (2, 7)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2MAN5Ligand/IonALPHA-D-MANNOSE
3NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
4OXY-1Ligand/IonOXYGEN MOLECULE
Biological Unit 2 (2, 3)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2MAN-1Ligand/IonALPHA-D-MANNOSE
3NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
4OXY1Ligand/IonOXYGEN MOLECULE
Biological Unit 3 (2, 4)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2MAN2Ligand/IonALPHA-D-MANNOSE
3NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
4OXY-1Ligand/IonOXYGEN MOLECULE
Biological Unit 4 (2, 2)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2MAN-1Ligand/IonALPHA-D-MANNOSE
3NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE
4OXY1Ligand/IonOXYGEN MOLECULE
Biological Unit 5 (3, 10)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2MAN5Ligand/IonALPHA-D-MANNOSE
3NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE
4OXY1Ligand/IonOXYGEN MOLECULE
Biological Unit 6 (2, 4)
No.NameCountTypeFull Name
1CU-1Ligand/IonCOPPER (II) ION
2MAN2Ligand/IonALPHA-D-MANNOSE
3NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
4OXY-1Ligand/IonOXYGEN MOLECULE

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:1 , HIS A:84 , GLN A:166 , TYR A:168 , HOH B:405binding site for residue CU A 308
02AC2SOFTWAREGLU A:30 , HOH A:418 , HIS B:84 , HIS B:157 , GLN B:166 , CU B:303binding site for residue OXY B 309
03AC3SOFTWAREOXY B:309 , HIS B:1 , HIS B:84 , GLN B:166 , TYR B:168binding site for residue CU B 303
04AC4SOFTWAREHIS C:1 , HIS C:84 , GLN C:166 , TYR C:168 , HOH D:415binding site for residue CU C 305
05AC5SOFTWAREHIS D:1 , HIS D:84 , GLN D:166 , TYR D:168 , OXY D:303 , HOH D:544binding site for residue CU D 302
06AC6SOFTWAREGLU C:30 , HIS D:84 , HIS D:157 , GLN D:166 , CU D:302binding site for residue OXY D 303
07AC7SOFTWAREASN A:60 , ASP A:114 , GLY A:115 , MET A:116 , ASP A:117 , ARG A:126 , SER A:135 , ILE A:136 , LYS A:137 , HOH A:405 , HOH A:410 , HOH A:411 , HOH A:412 , HOH A:422 , HOH A:435 , HOH A:461 , HOH A:462 , HOH A:476 , HOH A:481 , HOH A:482 , HOH A:510 , HOH A:517 , HOH A:530 , HOH A:533 , SER C:48 , HOH C:467binding site for Poly-Saccharide residues NAG A 301 through MAN A 307 bound to ASN A 60
08AC8SOFTWAREASN B:60 , GLN B:112 , GLN B:113 , SER B:135 , ILE B:136 , LYS B:137 , HOH B:406 , HOH B:437 , HOH B:442binding site for Poly-Saccharide residues NAG B 301 through NAG B 302 bound to ASN B 60
09AC9SOFTWARESER A:48 , SER A:50 , ASN C:60 , GLN C:112 , ASP C:117 , VAL C:121 , ARG C:126 , SER C:135 , ILE C:136 , LYS C:137 , HOH C:421 , HOH C:445 , HOH C:497 , HOH C:501 , HOH C:505 , HOH C:535 , HOH C:612binding site for Poly-Saccharide residues NAG C 301 through MAN C 304 bound to ASN C 60
10AD1SOFTWAREASN D:60 , GLN D:112 , SER D:135 , LYS D:137 , HOH D:428binding site for Mono-Saccharide NAG D 301 bound to ASN D 60

(-) SS Bonds  (8, 8)

Asymmetric Unit
No.Residues
1A:39 -A:171
2A:141 -A:223
3B:39 -B:171
4B:141 -B:223
5C:39 -C:171
6C:141 -C:223
7D:39 -D:171
8D:141 -D:223

(-) Cis Peptide Bonds  (16, 16)

Asymmetric Unit
No.Residues
1Ser A:42 -Pro A:43
2Tyr A:162 -Pro A:163
3Phe A:190 -Pro A:191
4Trp A:207 -Pro A:208
5Ser B:42 -Pro B:43
6Tyr B:162 -Pro B:163
7Phe B:190 -Pro B:191
8Trp B:207 -Pro B:208
9Ser C:42 -Pro C:43
10Tyr C:162 -Pro C:163
11Phe C:190 -Pro C:191
12Trp C:207 -Pro C:208
13Ser D:42 -Pro D:43
14Tyr D:162 -Pro D:163
15Phe D:190 -Pro D:191
16Trp D:207 -Pro D:208

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5TKF)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5TKF)

(-) Exons   (0, 0)

(no "Exon" information available for 5TKF)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:223
                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee..ee......ee............hhhhh..............eeee...eeeeeee........hhhhh........eeeeeee..........eeeeeeeeee.......hhhhhhhh...eeeee.......eeeeeeeeeee..........eeeeeeeeeeee..........eee................................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5tkf A   1 HTIFSSLEVNGVNQGLGEGVRVPTYNGPIEDVTSASIACNGSPNTVASTSKVITVQAGTNVTAIWRYMLSTTGDSPADVMDSSHKGPTIAYLKKVDNAATASGVGNGWFKIQQDGMDSSGVWGTERVINGKGRHSIKIPECIAPGQYLLRAEMIALHAASNYPGAQFYMECAQLNVVGGTGAKTPSTVSFPGAYSGSDPGVKISIYWPPVTSYTVPGPSVFTC 223
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220   


Chain B from PDB  Type:PROTEIN  Length:223
                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee..ee......ee............hhhhh..............eeee...eeeeeee........hhhhhh.......eeeeeee..........eeeeeeeeee.......hhhhhhhh...eeeee.......eeeeeeeeeee..........eeeeeeeeeeee..........eee................................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5tkf B   1 HTIFSSLEVNGVNQGLGEGVRVPTYNGPIEDVTSASIACNGSPNTVASTSKVITVQAGTNVTAIWRYMLSTTGDSPADVMDSSHKGPTIAYLKKVDNAATASGVGNGWFKIQQDGMDSSGVWGTERVINGKGRHSIKIPECIAPGQYLLRAEMIALHAASNYPGAQFYMECAQLNVVGGTGAKTPSTVSFPGAYSGSDPGVKISIYWPPVTSYTVPGPSVFTC 223
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220   


Chain C from PDB  Type:PROTEIN  Length:223
                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee..ee......ee............hhhhh..............eeee...eeeeeee........hhhhh........eeeeeee..........eeeeeeeeee.......hhhhhhhh...eeeee.......eeeeeeeeeee..........eeeeeeeeeeee..........eee................................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5tkf C   1 HTIFSSLEVNGVNQGLGEGVRVPTYNGPIEDVTSASIACNGSPNTVASTSKVITVQAGTNVTAIWRYMLSTTGDSPADVMDSSHKGPTIAYLKKVDNAATASGVGNGWFKIQQDGMDSSGVWGTERVINGKGRHSIKIPECIAPGQYLLRAEMIALHAASNYPGAQFYMECAQLNVVGGTGAKTPSTVSFPGAYSGSDPGVKISIYWPPVTSYTVPGPSVFTC 223
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220   


Chain D from PDB  Type:PROTEIN  Length:223
                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee..ee......ee............hhhhh..............eeee...eeeeeee........hhhhh........eeeeeee..........eeeeeeeeee.......hhhhhhhh...eeeee.......eeeeeeeeeee..........eeeeeeeeeeee..........eee................................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5tkf D   1 HTIFSSLEVNGVNQGLGEGVRVPTYNGPIEDVTSASIACNGSPNTVASTSKVITVQAGTNVTAIWRYMLSTTGDSPADVMDSSHKGPTIAYLKKVDNAATASGVGNGWFKIQQDGMDSSGVWGTERVINGKGRHSIKIPECIAPGQYLLRAEMIALHAASNYPGAQFYMECAQLNVVGGTGAKTPSTVSFPGAYSGSDPGVKISIYWPPVTSYTVPGPSVFTC 223
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5TKF)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5TKF)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5TKF)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OXY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Phe A:190 - Pro A:191   [ RasMol ]  
    Phe B:190 - Pro B:191   [ RasMol ]  
    Phe C:190 - Pro C:191   [ RasMol ]  
    Phe D:190 - Pro D:191   [ RasMol ]  
    Ser A:42 - Pro A:43   [ RasMol ]  
    Ser B:42 - Pro B:43   [ RasMol ]  
    Ser C:42 - Pro C:43   [ RasMol ]  
    Ser D:42 - Pro D:43   [ RasMol ]  
    Trp A:207 - Pro A:208   [ RasMol ]  
    Trp B:207 - Pro B:208   [ RasMol ]  
    Trp C:207 - Pro C:208   [ RasMol ]  
    Trp D:207 - Pro D:208   [ RasMol ]  
    Tyr A:162 - Pro A:163   [ RasMol ]  
    Tyr B:162 - Pro B:163   [ RasMol ]  
    Tyr C:162 - Pro C:163   [ RasMol ]  
    Tyr D:162 - Pro D:163   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format | Biol. Unit 5 PNG format | Biol. Unit 6 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5tkf
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8WZQ2_NEUCS | Q8WZQ2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8WZQ2_NEUCS | Q8WZQ2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Q8WZQ2_NEUCS | Q8WZQ2: 5tkg 5tkh 5tki

(-) Related Entries Specified in the PDB File

5tkg 5tkh 5tki