Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN TYROSINASE RELATED PROTEIN 1 MUTANT (T391V-R374S-Y362F) IN COMPLEX WITH KOJIC ACID
 
Authors :  X. Lai, M. Soler-Lopez, H. J. Wichers, B. W. Dijkstra
Date :  29 Oct 16  (Deposition) - 12 Jul 17  (Release) - 12 Jul 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.85
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Human Tyrosinase Related Protein 1, Melanin Biosynthesis, Tyrosinase, Oxidoreductase, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  X. Lai, H. J. Wichers, M. Soler-Lopez, B. W. Dijkstra
Structure Of Human Tyrosinase Related Protein 1 Reveals A Binuclear Zinc Active Site Important For Melanogenesis.
Angew. Chem. Int. Ed. Engl. 2017
PubMed-ID: 28661582  |  Reference-DOI: 10.1002/ANIE.201704616

(-) Compounds

Molecule 1 - 5,6-DIHYDROXYINDOLE-2-CARBOXYLIC ACID OXIDASE
    Chains: A, B, C, D
    EC Number: 1.14.18.-
    Engineered: YES
    Expression System: SPODOPTERA FRUGIPERDA
    Expression System Taxid: 7108
    Gene: TYRP1, CAS2, TYRP, TYRRP
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: DHICA OXIDASE,CATALASE B,GLYCOPROTEIN 75,MELANOMA ANTIGEN GP75,TYROSINASE-RELATED PROTEIN 1,TRP1

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A   
Biological Unit 2 (1x):  B  
Biological Unit 3 (1x):   C 
Biological Unit 4 (1x):    D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 49)

Asymmetric Unit (5, 49)
No.NameCountTypeFull Name
1FUC5Ligand/IonALPHA-L-FUCOSE
2KOJ4Ligand/Ion5-HYDROXY-2-(HYDROXYMETHYL)-4H-PYRAN-4-ONE
3MAN6Ligand/IonALPHA-D-MANNOSE
4NAG25Ligand/IonN-ACETYL-D-GLUCOSAMINE
5ZN9Ligand/IonZINC ION
Biological Unit 1 (4, 14)
No.NameCountTypeFull Name
1FUC1Ligand/IonALPHA-L-FUCOSE
2KOJ1Ligand/Ion5-HYDROXY-2-(HYDROXYMETHYL)-4H-PYRAN-4-ONE
3MAN3Ligand/IonALPHA-D-MANNOSE
4NAG9Ligand/IonN-ACETYL-D-GLUCOSAMINE
5ZN-1Ligand/IonZINC ION
Biological Unit 2 (3, 6)
No.NameCountTypeFull Name
1FUC1Ligand/IonALPHA-L-FUCOSE
2KOJ1Ligand/Ion5-HYDROXY-2-(HYDROXYMETHYL)-4H-PYRAN-4-ONE
3MAN-1Ligand/IonALPHA-D-MANNOSE
4NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE
5ZN-1Ligand/IonZINC ION
Biological Unit 3 (4, 12)
No.NameCountTypeFull Name
1FUC1Ligand/IonALPHA-L-FUCOSE
2KOJ1Ligand/Ion5-HYDROXY-2-(HYDROXYMETHYL)-4H-PYRAN-4-ONE
3MAN3Ligand/IonALPHA-D-MANNOSE
4NAG7Ligand/IonN-ACETYL-D-GLUCOSAMINE
5ZN-1Ligand/IonZINC ION
Biological Unit 4 (3, 8)
No.NameCountTypeFull Name
1FUC2Ligand/IonALPHA-L-FUCOSE
2KOJ1Ligand/Ion5-HYDROXY-2-(HYDROXYMETHYL)-4H-PYRAN-4-ONE
3MAN-1Ligand/IonALPHA-D-MANNOSE
4NAG5Ligand/IonN-ACETYL-D-GLUCOSAMINE
5ZN-1Ligand/IonZINC ION

(-) Sites  (31, 31)

Asymmetric Unit (31, 31)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:377 , HIS A:381 , HIS A:404 , ZN A:515 , KOJ A:516 , HOH A:601binding site for residue ZN A 514
02AC2SOFTWAREHIS A:192 , HIS A:215 , HIS A:224 , ZN A:514 , KOJ A:516 , HOH A:601binding site for residue ZN A 515
03AC3SOFTWAREHIS A:192 , HIS A:215 , HIS A:377 , ASN A:378 , HIS A:381 , LEU A:382 , GLY A:389 , VAL A:391 , SER A:394 , ZN A:514 , ZN A:515 , HOH A:601binding site for residue KOJ A 516
04AC4SOFTWAREARG B:164 , GLU B:180 , SER B:292 , ASP B:295 , TYR B:296 , ASN B:304binding site for residue NAG B 504
05AC5SOFTWAREHIS B:192 , HIS B:215 , HIS B:224 , ZN B:507 , KOJ B:508 , HOH B:601binding site for residue ZN B 506
06AC6SOFTWAREHIS B:377 , HIS B:381 , PHE B:400 , HIS B:404 , ZN B:506 , KOJ B:508 , HOH B:601binding site for residue ZN B 507
07AC7SOFTWAREHIS B:215 , HIS B:377 , ASN B:378 , HIS B:381 , LEU B:382 , GLY B:389 , GLN B:390 , VAL B:391 , SER B:394 , ZN B:506 , ZN B:507 , HOH B:601binding site for residue KOJ B 508
08AC8SOFTWAREARG C:28 , ASN C:181binding site for residue NAG C 503
09AC9SOFTWAREHIS C:377 , HIS C:381 , HIS C:404 , ZN C:513 , KOJ C:514 , HOH C:601binding site for residue ZN C 512
10AD1SOFTWAREHIS C:192 , HIS C:215 , HIS C:224 , ZN C:512 , KOJ C:514 , HOH C:601binding site for residue ZN C 513
11AD2SOFTWAREHIS C:192 , HIS C:215 , HIS C:377 , ASN C:378 , HIS C:381 , GLY C:389 , VAL C:391 , SER C:394 , ZN C:512 , ZN C:513 , HOH C:601binding site for residue KOJ C 514
12AD3SOFTWAREGLU C:66 , HIS C:100 , ARG D:64 , GLU D:66 , HIS D:100binding site for residue ZN C 515
13AD4SOFTWAREHIS D:377 , HIS D:381 , HIS D:404 , ZN D:509 , KOJ D:510 , HOH D:601binding site for residue ZN D 508
14AD5SOFTWAREHIS D:192 , HIS D:215 , HIS D:224 , ZN D:508 , KOJ D:510 , HOH D:601binding site for residue ZN D 509
15AD6SOFTWAREHIS D:192 , HIS D:215 , HIS D:377 , HIS D:381 , LEU D:382 , GLY D:389 , VAL D:391 , SER D:394 , ZN D:508 , ZN D:509 , HOH D:601binding site for residue KOJ D 510
16AD7SOFTWARELEU A:36 , ARG A:37 , SER A:38 , GLY A:39 , ARG A:93 , PHE A:94 , ASN A:96binding site for Poly-Saccharide residues NAG A 501 through FUC A 503 bound to ASN A 96
17AD8SOFTWAREARG A:28 , ASN A:181binding site for Mono-Saccharide NAG A 504 bound to ASN A 181
18AD9SOFTWAREARG A:164 , SER A:292 , ASP A:295 , ASN A:304binding site for Poly-Saccharide residues NAG A 505 through NAG A 506 bound to ASN A 304
19AE1SOFTWAREASN A:350 , ARG B:62 , GLY B:111 , ARG B:118 , GLY B:119 , ALA B:120 , GLN B:124binding site for Poly-Saccharide residues NAG A 507 through MAN A 511 bound to ASN A 350
20AE2SOFTWAREGLY A:317 , ASN A:318 , VAL A:319 , ALA A:320 , ASN A:385 , GLY A:386binding site for Poly-Saccharide residues NAG A 512 through NAG A 513 bound to ASN A 385
21AE3SOFTWAREARG B:37 , ASN B:96binding site for Mono-Saccharide NAG B 501 bound to ASN B 96
22AE4SOFTWAREARG B:28 , PHE B:179 , ASN B:181binding site for Poly-Saccharide residues NAG B 502 through FUC B 503 bound to ASN B 181
23AE5SOFTWAREGLY B:317 , ASN B:318 , VAL B:319 , ALA B:320 , ASN B:385 , GLY B:386binding site for Mono-Saccharide NAG B 505 bound to ASN B 385
24AE6SOFTWAREARG C:37 , SER C:38 , GLY C:39 , ARG C:93 , PHE C:94 , ASN C:96binding site for Poly-Saccharide residues NAG C 501 through FUC C 502 bound to ASN C 96
25AE7SOFTWAREARG C:164 , GLU C:180 , SER C:292 , ASP C:295 , TYR C:296 , ASN C:304binding site for Poly-Saccharide residues NAG C 504 through NAG C 505 bound to ASN C 304
26AE8SOFTWAREASN C:350 , SER D:46 , SER D:60 , GLY D:111 , ARG D:118 , GLY D:119 , ALA D:120 , GLN D:124binding site for Poly-Saccharide residues NAG C 506 through MAN C 510 bound to ASN C 350
27AE9SOFTWAREASN C:318 , VAL C:319 , ALA C:320 , ASN C:385 , GLY C:386binding site for Mono-Saccharide NAG C 511 bound to ASN C 385
28AF1SOFTWAREVAL A:48 , ARG D:37 , SER D:38 , ARG D:93 , PHE D:94 , ASN D:96binding site for Poly-Saccharide residues NAG D 501 through FUC D 502 bound to ASN D 96
29AF2SOFTWAREASN D:181binding site for Poly-Saccharide residues NAG D 503 through FUC D 504 bound to ASN D 181
30AF3SOFTWAREARG D:164 , SER D:292 , ASP D:295 , ASN D:304 , ASP D:308binding site for Poly-Saccharide residues NAG D 505 through NAG D 506 bound to ASN D 304
31AF4SOFTWAREASN D:318 , VAL D:319 , ALA D:320 , ASN D:385 , GLY D:386binding site for Mono-Saccharide NAG D 507 bound to ASN D 385

(-) SS Bonds  (28, 28)

Asymmetric Unit
No.Residues
1A:30 -A:41
2A:42 -A:65
3A:56 -A:99
4A:101 -A:110
5A:113 -A:122
6A:258 -A:261
7A:290 -A:303
8B:30 -B:41
9B:42 -B:65
10B:56 -B:99
11B:101 -B:110
12B:113 -B:122
13B:258 -B:261
14B:290 -B:303
15C:30 -C:41
16C:42 -C:65
17C:56 -C:99
18C:101 -C:110
19C:113 -C:122
20C:258 -C:261
21C:290 -C:303
22D:30 -D:41
23D:42 -D:65
24D:56 -D:99
25D:101 -D:110
26D:113 -D:122
27D:258 -D:261
28D:290 -D:303

(-) Cis Peptide Bonds  (16, 16)

Asymmetric Unit
No.Residues
1Trp A:90 -Pro A:91
2Pro A:345 -Pro A:346
3Val A:441 -Pro A:442
4Trp A:444 -Pro A:445
5Trp B:90 -Pro B:91
6Pro B:345 -Pro B:346
7Val B:441 -Pro B:442
8Trp B:444 -Pro B:445
9Trp C:90 -Pro C:91
10Pro C:345 -Pro C:346
11Val C:441 -Pro C:442
12Trp C:444 -Pro C:445
13Trp D:90 -Pro D:91
14Pro D:345 -Pro D:346
15Val D:441 -Pro D:442
16Trp D:444 -Pro D:445

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5M8Q)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5M8Q)

(-) Exons   (0, 0)

(no "Exon" information available for 5M8Q)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:446
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.hhhhhhhhhhh..............hhhhh....eeeee.............................eeeee...ee.....ee...ee.....ee..eeee.hhhhhhhhhhhhhhhhhhhhhheeeeeeee..hhhhh.........eeeeehhhhhhhhhhhh......................hhhhhhhhhhhhhhhhhhhhhh.............................ee..eeeee...hhhhh......hhhhhhhhh....................hhhhh...hhhhhhhhh................hhhhhhhh.............hhhhhhhhhh.hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh......................hhhhhh.hhhhhhheeee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5m8q A  25 QFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGFSDPTGKYDPAVSSLHNLAHLFLNGTGGQVHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPS 470
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464      


Chain B from PDB  Type:PROTEIN  Length:446
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh...............hhhhh....ee...................................ee...ee.....ee...ee.....ee..eeee.hhhhhhhhhhhhhhhhhhhhhh......ee................ee..hhhhhhhhhhhhhhh....................hhhhhhhhhhhhhhhhhhhhhh.........................................hhhhh......hhhhhhhhh............................hhhhhh...................hhhhhhhh.............hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh......................hhhhhh.hhhhhh.eeee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5m8q B  25 QFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGFSDPTGKYDPAVSSLHNLAHLFLNGTGGQVHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPS 470
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464      


Chain C from PDB  Type:PROTEIN  Length:446
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh..............hhhhh....eeeee.............................eeeee...ee.....ee...ee.....ee..eee......hhhhhhhhhhhhhhhhhh......ee..hhhhh.........ee..hhhhhhhhhhhhhhh....................hhhhhhhhhhhhhhhhhhhhhhh............................ee..eeeee...hhhhh......hhhhhhhhh....................hhhhhh..hhhhhhhhh................hhhhhhhh.............hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh......................hhhhhh.hhhhhh.eee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5m8q C  25 QFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGFSDPTGKYDPAVSSLHNLAHLFLNGTGGQVHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPS 470
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464      


Chain D from PDB  Type:PROTEIN  Length:446
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh..............hhhhh....eeeee.............................eeeee...ee.....ee...ee.....ee..eee.hhhhhhhhhhhhhhhhhhhhhhheeeeeeee..hhhhh.........eeeeehhhhhhhhhhhh......................hhhhhhhhhhhhhhhhhhhhhhh........................................hhhhhh.....hhhhhhhhh....................hhhhh...hhhhhhhhh................hhhhhhhh.............hhhhhhhhhh.hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh.............................hhhhhh.hhhhhh.eee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5m8q D  25 QFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGFSDPTGKYDPAVSSLHNLAHLFLNGTGGQVHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPS 470
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5M8Q)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5M8Q)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5M8Q)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5M8Q)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FUC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    KOJ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro A:345 - Pro A:346   [ RasMol ]  
    Pro B:345 - Pro B:346   [ RasMol ]  
    Pro C:345 - Pro C:346   [ RasMol ]  
    Pro D:345 - Pro D:346   [ RasMol ]  
    Trp A:444 - Pro A:445   [ RasMol ]  
    Trp A:90 - Pro A:91   [ RasMol ]  
    Trp B:444 - Pro B:445   [ RasMol ]  
    Trp B:90 - Pro B:91   [ RasMol ]  
    Trp C:444 - Pro C:445   [ RasMol ]  
    Trp C:90 - Pro C:91   [ RasMol ]  
    Trp D:444 - Pro D:445   [ RasMol ]  
    Trp D:90 - Pro D:91   [ RasMol ]  
    Val A:441 - Pro A:442   [ RasMol ]  
    Val B:441 - Pro B:442   [ RasMol ]  
    Val C:441 - Pro C:442   [ RasMol ]  
    Val D:441 - Pro D:442   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5m8q
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TYRP1_HUMAN | P17643
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.14.18.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TYRP1_HUMAN | P17643
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TYRP1_HUMAN | P17643: 5m8l 5m8m 5m8n 5m8o 5m8p 5m8r 5m8t

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5M8Q)