Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  SMALL MOLECULE INHIBITORS OF IAP
 
Authors :  P. A. Williams
Date :  25 Oct 16  (Deposition) - 24 May 17  (Release) - 21 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Xiap, Apoptosis, Metal-Binding, Inhibitor, Xiap#1 (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  E. Tamanini, I. M. Buck, G. Chessari, E. Chiarparin, J. E. H. Day, M. Frederickson, C. M. Griffiths-Jones, K. Hearn, T. D. Heightman, A. Iqbal, C. N. Johnson, E. J. Lewis, V. Martins, T. Peakman, M. Reader, S. J. Rich, G. A. Ward, P. A. Williams, N. E. Wilsher
Discovery Of A Potent Nonpeptidomimetic, Small-Molecule Antagonist Of Cellular Inhibitor Of Apoptosis Protein 1 (Ciap1) And X-Linked Inhibitor Of Apoptosis Protein (Xiap).
J. Med. Chem. V. 60 4611 2017
PubMed-ID: 28492317  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.6B01877

(-) Compounds

Molecule 1 - BACULOVIRAL IAP REPEAT-CONTAINING PROTEIN 2
    Chains: A, B
    EC Number: 6.3.2.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PET28B
    Gene: BIRC2, API1, MIHB, RNF48
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CELLULAR INHIBITOR OF APOPTOSIS 1,C-IAP1,IAP HOMOLOG B, INHIBITOR OF APOPTOSIS PROTEIN 2,HIAP2,RING FINGER PROTEIN 48,TNFR2- TRAF-SIGNALING COMPLEX PROTEIN 2

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 9)

Asymmetric Unit (3, 9)
No.NameCountTypeFull Name
17H92Ligand/Ion1-[6-[(4-FLUOROPHENYL)METHYL]-3,3-DIMETHYL-2~{H}-PYRROLO[3,2-B]PYRIDIN-1-YL]-2-[(2~{R},5~{R})-5-METHYL-2-[[(3~{R})-3-METHYLMORPHOLIN-4-YL]METHYL]PIPERAZIN-4-IUM-1-YL]ETHANONE
2SO45Ligand/IonSULFATE ION
3ZN2Ligand/IonZINC ION
Biological Unit 1 (2, 3)
No.NameCountTypeFull Name
17H91Ligand/Ion1-[6-[(4-FLUOROPHENYL)METHYL]-3,3-DIMETHYL-2~{H}-PYRROLO[3,2-B]PYRIDIN-1-YL]-2-[(2~{R},5~{R})-5-METHYL-2-[[(3~{R})-3-METHYLMORPHOLIN-4-YL]METHYL]PIPERAZIN-4-IUM-1-YL]ETHANONE
2SO42Ligand/IonSULFATE ION
3ZN-1Ligand/IonZINC ION
Biological Unit 2 (2, 4)
No.NameCountTypeFull Name
17H91Ligand/Ion1-[6-[(4-FLUOROPHENYL)METHYL]-3,3-DIMETHYL-2~{H}-PYRROLO[3,2-B]PYRIDIN-1-YL]-2-[(2~{R},5~{R})-5-METHYL-2-[[(3~{R})-3-METHYLMORPHOLIN-4-YL]METHYL]PIPERAZIN-4-IUM-1-YL]ETHANONE
2SO43Ligand/IonSULFATE ION
3ZN-1Ligand/IonZINC ION

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:300 , CYS A:303 , HIS A:320 , CYS A:327binding site for residue ZN A 1001
2AC2SOFTWAREHIS A:259 , MET A:260 , HOH A:1113 , HOH A:1123 , HOH A:1203binding site for residue SO4 A 1002
3AC3SOFTWAREHIS A:348 , GLU A:351 , HOH A:1129 , HOH A:1133 , HOH A:1143 , GLU B:282 , GLN B:283 , SER B:286 , HOH B:1126binding site for residue SO4 A 1003
4AC4SOFTWAREGLN A:261 , ASP A:297 , VAL A:298 , LYS A:299 , GLY A:306 , LEU A:307 , ARG A:308 , CYS A:309 , TRP A:310 , ASP A:314 , GLU A:319 , TRP A:323 , PHE A:324 , HOH A:1179 , HOH A:1217 , HOH A:1248 , ARG B:268 , MET B:271binding site for residue 7H9 A 1004
5AC5SOFTWARECYS B:300 , CYS B:303 , HIS B:320 , CYS B:327binding site for residue ZN B 1001
6AC6SOFTWARETHR B:262 , ALA B:265 , ARG B:268 , HOH B:1128binding site for residue SO4 B 1002
7AC7SOFTWARETHR B:262 , HIS B:263 , HOH B:1103 , HOH B:1120 , HOH B:1134binding site for residue SO4 B 1003
8AC8SOFTWARELYS A:322 , TRP A:323 , ARG A:332 , MET B:271 , TYR B:272 , HOH B:1117 , HOH B:1169binding site for residue SO4 B 1004
9AC9SOFTWARELEU A:350 , HOH A:1287 , ASP B:297 , VAL B:298 , LYS B:299 , GLY B:306 , LEU B:307 , ARG B:308 , CYS B:309 , TRP B:310 , ASP B:314 , GLU B:319 , TRP B:323 , PHE B:324 , HOH B:1107 , HOH B:1139 , HOH B:1144 , HOH B:1173binding site for residue 7H9 B 1005

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5M6N)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5M6N)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5M6N)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5M6N)

(-) Exons   (0, 0)

(no "Exon" information available for 5M6N)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:100
                                                                                                                                    
               SCOP domains ---------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhh......hhhhhhhh.eee......eee.....ee.......hhhhhhhhhh..hhhhhhhhhhhhhhhhh....hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------- Transcript
                 5m6n A 257 GSHMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLST 356
                                   266       276       286       296       306       316       326       336       346       356


Chain B from PDB  Type:PROTEIN  Length:92
                                                                                                                            
               SCOP domains -------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh......hhhhhhhh.eee......eee.....ee.......hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                 5m6n B 259 HMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLL 350
                                   268       278       288       298       308       318       328       338       348
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5M6N)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5M6N)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5M6N)

(-) Gene Ontology  (60, 60)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    7H9  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5m6n)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5m6n
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BIRC2_HUMAN | Q13490
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.3.2.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  BIRC2_HUMAN | Q13490
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BIRC2_HUMAN | Q13490: 1qbh 2l9m 3d9t 3d9u 3m1d 3mup 3oz1 3t6p 3uw4 4eb9 4hy4 4hy5 4kmn 4lge 4lgu 4mti 4mu7

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5M6N)