Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  JMJD2A/ KDM4A COMPLEXED WITH NI(II), NOG AND MACROCYCLIC PEPTIDE INHIBITOR CP2_R6KME3 (13-MER)
 
Authors :  R. Chowdhury, S. K. Madden, R. Hopkinson, C. J. Schofield
Date :  23 Sep 16  (Deposition) - 12 Apr 17  (Release) - 19 Apr 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.43
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,G,H
Keywords :  Jmjd2A, Kdm4A, Oxidoreductase, Non-Heme, Iron, 2-Oxoglutarate, Dioxygenase, Oxygenase, Double-Stranded Beta Helix, Dsbh, Facial Triad, Demethylase, Histone, Jmjc Domain, Metal Binding Protein, Epigenetic And Transcription Regulation, Chromatin Regulator, Hydroxylation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Kawamura, M. Munzel, T. Kojima, C. Yapp, B. Bhushan, Y. Goto, A. Tumber, T. Katoh, O. N. King, T. Passioura, L. J. Walport, S. B. Hatch S. Madden, S. Muller, P. E. Brennan, R. Chowdhury, R. J. Hopkinson, H. Suga, C. J. Schofield
Highly Selective Inhibition Of Histone Demethylases By De Novo Macrocyclic Peptides.
Nat Commun V. 8 14773 2017
PubMed-ID: 28382930  |  Reference-DOI: 10.1038/NCOMMS14773
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - LYSINE-SPECIFIC DEMETHYLASE 4A
    Chains: A, B, C, D
    EC Number: 1.14.11.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PNIC28-BSA4
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Variant: R3
    Expression System Vector Type: PLASMID
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Other Details: FRAGMENT: CATALYTIC DOMAIN (1-359)
    Synonym: JMJC DOMAIN-CONTAINING HISTONE DEMETHYLATION PROTEIN 3A, JUMONJI DOMAIN-CONTAINING PROTEIN 2A
 
Molecule 2 - CP2_R6KME3
    Chains: E, F, G, H
    Engineered: YES
    Organism Scientific: ARTIFICIAL SEQUENCES
    Organism Taxid: 81077
    Other Details: SYNTHETIC PEPTIDE
    Other Details - Source: CHEMICALLY SYNTHESIZED
    Synthetic: YES

 Structural Features

(-) Chains, Units

  12345678
Asymmetric/Biological Unit : ABCDEFGH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (8, 30)

Asymmetric/Biological Unit (8, 30)
No.NameCountTypeFull Name
148V2Mod. Amino Acid{[(2R)-2,3-DIAMINO-3-OXOPROPYL]SULFANYL}ACETIC ACID
2CL5Ligand/IonCHLORIDE ION
3DTY2Mod. Amino AcidD-TYROSINE
4GOL5Ligand/IonGLYCEROL
5M3L4Mod. Amino AcidN-TRIMETHYLLYSINE
6NI4Ligand/IonNICKEL (II) ION
7OGA4Ligand/IonN-OXALYLGLYCINE
8ZN4Ligand/IonZINC ION

(-) Sites  (32, 32)

Asymmetric Unit (32, 32)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:188 , GLU A:190 , HIS A:276 , OGA A:503 , HOH A:663binding site for residue NI A 501
02AC2SOFTWARECYS A:234 , HIS A:240 , CYS A:306 , CYS A:308binding site for residue ZN A 502
03AC3SOFTWARETYR A:132 , PHE A:185 , HIS A:188 , GLU A:190 , SER A:196 , ASN A:198 , LYS A:206 , HIS A:276 , SER A:288 , NI A:501 , HOH A:663 , M3L E:6 , HOH E:102binding site for residue OGA A 503
04AC4SOFTWAREASP A:311 , TYR E:3binding site for residue GOL A 504
05AC5SOFTWARETYR A:59 , ASP A:60binding site for residue GOL A 505
06AC6SOFTWAREGLY A:229 , LYS B:105binding site for residue CL B 401
07AC7SOFTWAREHIS B:188 , GLU B:190 , HIS B:276 , OGA B:405 , HOH B:545binding site for residue NI B 402
08AC8SOFTWARECYS B:234 , HIS B:240 , CYS B:306 , CYS B:308binding site for residue ZN B 403
09AC9SOFTWAREGLY B:229 , SER B:230binding site for residue CL B 404
10AD1SOFTWARETYR B:132 , PHE B:185 , HIS B:188 , GLU B:190 , SER B:196 , ASN B:198 , LYS B:206 , HIS B:276 , NI B:402 , HOH B:545 , M3L F:6binding site for residue OGA B 405
11AD2SOFTWAREGLY B:138 , THR B:139binding site for residue GOL B 406
12AD3SOFTWAREASP B:191 , ARG B:239 , HIS B:240 , CYS B:306 , VAL B:313 , HOH B:527 , ASN F:4 , TRP F:9binding site for residue GOL B 407
13AD4SOFTWARETYR B:85 , ASN B:86 , MET B:242 , TRP F:9binding site for residue GOL B 408
14AD5SOFTWAREHIS C:188 , GLU C:190 , HIS C:276 , OGA C:504 , HOH C:641binding site for residue NI C 501
15AD6SOFTWARECYS C:234 , HIS C:240 , CYS C:306 , CYS C:308binding site for residue ZN C 502
16AD7SOFTWARETYR C:59 , ARG C:98binding site for residue CL C 503
17AD8SOFTWARETYR C:132 , PHE C:185 , HIS C:188 , GLU C:190 , SER C:196 , ASN C:198 , LYS C:206 , TRP C:208 , HIS C:276 , SER C:288 , NI C:501 , HOH C:641 , HOH G:101binding site for residue OGA C 504
18AD9SOFTWAREPHE C:227 , LYS D:105binding site for residue CL D 401
19AE1SOFTWAREHIS D:188 , GLU D:190 , HIS D:276 , OGA D:405 , HOH D:528binding site for residue NI D 402
20AE2SOFTWARECYS D:234 , HIS D:240 , CYS D:306 , CYS D:308binding site for residue ZN D 403
21AE3SOFTWAREPHE D:227 , GLY D:229 , SER D:230binding site for residue CL D 404
22AE4SOFTWARETYR D:132 , PHE D:185 , HIS D:188 , GLU D:190 , SER D:196 , ASN D:198 , LYS D:206 , SER D:288 , NI D:402 , HOH D:528 , HOH D:561binding site for residue OGA D 405
23AE5SOFTWAREASP A:135 , GLY A:170 , TYR A:177 , GLU A:190 , LYS A:241 , SER A:288 , THR A:289 , ASN A:290 , OGA A:503 , THR E:5 , GLY E:8 , HOH E:101 , HOH E:102 , HOH E:103binding site for Ligand residues M3L E 6 through SER E 7 bound to THR E 5
24AE6SOFTWAREASN B:86 , ALA B:134 , ASP B:135 , GLY B:170 , TYR B:177 , GLU B:190 , LYS B:241 , SER B:288 , THR B:289 , ASN B:290 , OGA B:405 , HOH B:545 , THR F:5 , GLY F:8 , HOH F:101 , HOH F:102binding site for Ligand residues M3L F 6 through SER F 7 bound to THR F 5
25AE7SOFTWAREASP C:135 , TYR C:177 , LYS C:241 , SER C:288 , ASN C:290 , THR G:5 , GLY G:8 , HOH G:101binding site for Ligand residues M3L G 6 through SER G 7 bound to THR G 5
26AE8SOFTWAREASP D:135 , GLY D:170 , TYR D:175 , TYR D:177 , GLU D:190 , LYS D:241 , SER D:288 , ASN D:290 , THR H:5 , GLY H:8 , HOH H:101binding site for Ligand residues M3L H 6 through SER H 7 bound to THR H 5
27AE9SOFTWAREGLN B:88 , DTY E:1 , TYR E:12 , TYR F:3 , ARG F:10binding site for Di-peptide 48V E 0 and THR E 13
28AF1SOFTWAREGLN B:88 , LYS B:89 , LYS B:90 , HOH B:504 , VAL E:2 , TRP E:11 , TYR E:12 , THR E:13 , TYR F:3binding site for Di-peptide 48V E 0 and DTY E 1
29AF2SOFTWAREARG A:309 , GLN B:88 , LYS B:89 , LYS B:90 , HOH B:504 , 48V E:0 , TYR E:3 , ARG E:10 , TRP E:11 , TYR E:12binding site for Di-peptide DTY E 1 and VAL E 2
30AF3SOFTWAREGLN D:88 , LYS D:90 , HOH D:527 , VAL G:2 , TRP G:11 , TYR G:12 , THR G:13 , TYR H:3binding site for Di-peptide 48V G 0 and DTY G 1
31AF4SOFTWAREGLN D:88 , DTY G:1 , TYR G:12 , TYR H:3 , ARG H:10binding site for Di-peptide 48V G 0 and THR G 13
32AF5SOFTWAREARG C:309 , LYS D:90 , HOH D:527 , 48V G:0 , TYR G:3 , ARG G:10 , TRP G:11 , TYR G:12binding site for Di-peptide DTY G 1 and VAL G 2

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5LY2)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5LY2)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5LY2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5LY2)

(-) Exons   (0, 0)

(no "Exon" information available for 5LY2)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:348
                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........ee..hhhhhhhhhhhhhhhhhhhhhhh.eeee..................ee...eeeeeeee..eeeeeeee...eehhhhhhhhhh.........hhhhhhhhhhhhh.....eeeeeee.................hhhhhhhhhhh.........eeeee....eeeee.hhhhheeeeeeeee..eeeee.hhhhhhhhhhhhhhhhhhhhhhh.hhhhhh.eeehhhhhhhh....eeeee....eeee.....eeeee...eeeeeeee...hhhhhhhhh.............hhhhhhhhh..hhhhhhh............hhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5ly2 A   7 TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL 354
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346        


Chain B from PDB  Type:PROTEIN  Length:345
                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee..hhhhhhhhhhhhhhhhhhhhhhh.eeee..................ee...eeeeeeee..eeeeeeee...eehhhhhhhhh..........hhhhhhhhhhhh......eeeeeee...........hhhhh.hhhhhhhhhhh.........eeeee....eeeee.hhhhheeeeeeeee..eeeee.hhhhhhhhhhhhhhhhhhhhhhh.hhhhhh.eeehhhhhhhh....eeeee....eeee.....eeeee...eeeeeeee...hhhhhhhhh.............hhhhhhhhh..hhhhhhhh...........hhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ly2 B  10 PSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL 354
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349     


Chain C from PDB  Type:PROTEIN  Length:342
                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..........eee..hhhhhhhhhhhhhhhhhhhhhhh.eeee..................ee...eeeeeeee..eeeeeeee...eehhhhhhhhhh.........hhhhhhhhhhhhh.....eeeeeee.................hhhhhhh.....eeeee....eeeee.hhhhheeeeeeeee..eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhhh.eeehhhhhhhh....eeeee....eeee....eeeeee...eeeeeeee...hhhhhhhhh.............hhhhhhhhh..hhhhhhh............hhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5ly2 C   5 SETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL 354
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154      |172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352  
                                                                                                                                                                                      161|                                                                                                                                                                                        
                                                                                                                                                                                       170                                                                                                                                                                                        


Chain D from PDB  Type:PROTEIN  Length:347
                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.eee..hhhhhhhhhhhhhhhhhhhhhhh.eeee..................ee...eeeeeeee..eeeeeeee...eehhhhhhhhhh.........hhhhhhhhhhhh......eeeeeee...........hhhhh.hhhhhhhhhh..........eeeee....eeeee.hhhhheeeeeeeee..eeeee.hhhhhhhhhhhhhhhhhhhhhhh.hhhhhh.eeehhhhhhhh....eeeee....eeee.....eeeee...eeeeeeee...hhhhhhhh..............hhhhhhhhhhhhhhhhhhh...........hhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ly2 D   8 LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL 354
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       


Chain E from PDB  Type:PROTEIN  Length:14
                                              
               SCOP domains -------------- SCOP domains
               CATH domains -------------- CATH domains
               Pfam domains -------------- Pfam domains
         Sec.struct. author ..eeee..eeee.. Sec.struct. author
                 SAPs(SNPs) -------------- SAPs(SNPs)
                    PROSITE -------------- PROSITE
                 Transcript -------------- Transcript
                 5ly2 E   0 xxVYNTkSGWRWYT  13
                            ||    |  9    
                            0-48V |       
                             1-DTY|       
                                  6-M3L   


Chain F from PDB  Type:PROTEIN  Length:8
                                        
               SCOP domains -------- SCOP domains
               CATH domains -------- CATH domains
               Pfam domains -------- Pfam domains
         Sec.struct. author .ee..ee. Sec.struct. author
                 SAPs(SNPs) -------- SAPs(SNPs)
                    PROSITE -------- PROSITE
                 Transcript -------- Transcript
                 5ly2 F   3 YNTkSGWR  10
                               |    
                               6-M3L


Chain G from PDB  Type:PROTEIN  Length:14
                                              
               SCOP domains -------------- SCOP domains
               CATH domains -------------- CATH domains
               Pfam domains -------------- Pfam domains
         Sec.struct. author ..eeee..eeee.. Sec.struct. author
                 SAPs(SNPs) -------------- SAPs(SNPs)
                    PROSITE -------------- PROSITE
                 Transcript -------------- Transcript
                 5ly2 G   0 xxVYNTkSGWRWYT  13
                            ||    |  9    
                            ||    |       
                            0-48V |       
                             1-DTY|       
                                  6-M3L   


Chain H from PDB  Type:PROTEIN  Length:8
                                        
               SCOP domains -------- SCOP domains
               CATH domains -------- CATH domains
               Pfam domains -------- Pfam domains
         Sec.struct. author .ee..ee. Sec.struct. author
                 SAPs(SNPs) -------- SAPs(SNPs)
                    PROSITE -------- PROSITE
                 Transcript -------- Transcript
                 5ly2 H   3 YNTkSGWR  10
                               |    
                               6-M3L
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5LY2)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5LY2)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5LY2)

(-) Gene Ontology  (25, 25)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    48V  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DTY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    M3L  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OGA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5ly2)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ly2
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KDM4A_HUMAN | O75164
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.14.11.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  KDM4A_HUMAN | O75164
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KDM4A_HUMAN | O75164: 2gf7 2gfa 2gp3 2gp5 2oq6 2oq7 2os2 2ot7 2ox0 2p5b 2pxj 2q8c 2q8d 2q8e 2qqr 2qqs 2vd7 2wwj 2ybk 2ybp 2ybs 3njy 3pdq 3rvh 3u4s 4ai9 4bis 4gd4 4ura 4v2v 4v2w 5a7n 5a7o 5a7p 5a7q 5a7s 5a7w 5a80 5anq 5d6w 5d6x 5d6y 5f2s 5f2w 5f32 5f37 5f39 5f3c 5f3e 5f3g 5f3i 5f5i 5fpv 5fwe 5fy8 5fyc 5fyh 5fyi 5ly1 5tvr 5tvs

(-) Related Entries Specified in the PDB File

2ox0 2ybp 4ai9 4bis 4v2v 5ly1