Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN KDM4A IN COMPLEX WITH COMPOUND 15
 
Authors :  Y. -V. Le Bihan, S. Dempster, I. M. Westwood, R. L. M. Van Montfort
Date :  02 Dec 15  (Deposition) - 20 Jan 16  (Release) - 09 Mar 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.08
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Epigenetics, Demethylase, Inhibitor, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  V. Bavetsias, R. M. Lanigan, G. F. Ruda, B. Atrash, M. G. Mclaughlin, A. Tumber, N. Y. Mok, Y. V. Le Bihan, S. Dempster, K. J. Boxall, F. Jeganathan, S. B. Hatch, P. Savitsky, S. Velupillai, T. Krojer, K. S. England, J. Sejberg, C. Thai, A. Donovan, A. Pal, G. Scozzafava, J. M. Bennett, A. Kawamura, C. Johansson, A. Szykowska, C. Gileadi, N. A. Burgess-Brown, F. Von Delft, U. Oppermann, Z. Walters, J. Shipley, F. I. Raynaud, S. M. Westaway, R. K. Prinjha, O. Fedorov, R. Burke, C. J. Schofield, I. M. Westwood, C. Bountra, S. Muller, R. L. Van Montfort, P. E. Brennan, J. Blagg
8-Substituted Pyrido[3, 4-D]Pyrimidin-4(3H)-One Derivatives As Potent, Cell Permeable, Kdm4 (Jmjd2) And Kdm5 (Jarid1) Histone Lysine Demethylase Inhibitors.
J. Med. Chem. V. 59 1388 2016
PubMed-ID: 26741168  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.5B01635

(-) Compounds

Molecule 1 - LYSINE-SPECIFIC DEMETHYLASE 4A
    Chains: A, B, C, D
    EC Number: 1.14.11.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PNIC28
    Expression System Taxid: 469008
    Expression System Variant: ROSETTA2
    Expression System Vector Type: PLASMID
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: JMJC DOMAIN-CONTAINING HISTONE DEMETHYLATION PROTEIN 3A, JUMONJI DOMAIN-CONTAINING PROTEIN 2A

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A   
Biological Unit 2 (1x):  B  
Biological Unit 3 (1x):   C 
Biological Unit 4 (1x):    D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 54)

Asymmetric Unit (5, 54)
No.NameCountTypeFull Name
15TZ4Ligand/Ion2-(2-AZANYL-1,3-THIAZOL-4-YL)PYRIDINE-4-CARBOXYLIC ACID
2CL1Ligand/IonCHLORIDE ION
3DMS4Ligand/IonDIMETHYL SULFOXIDE
4EDO37Ligand/Ion1,2-ETHANEDIOL
5ZN8Ligand/IonZINC ION
Biological Unit 1 (3, 10)
No.NameCountTypeFull Name
15TZ1Ligand/Ion2-(2-AZANYL-1,3-THIAZOL-4-YL)PYRIDINE-4-CARBOXYLIC ACID
2CL-1Ligand/IonCHLORIDE ION
3DMS2Ligand/IonDIMETHYL SULFOXIDE
4EDO7Ligand/Ion1,2-ETHANEDIOL
5ZN-1Ligand/IonZINC ION
Biological Unit 2 (2, 12)
No.NameCountTypeFull Name
15TZ1Ligand/Ion2-(2-AZANYL-1,3-THIAZOL-4-YL)PYRIDINE-4-CARBOXYLIC ACID
2CL-1Ligand/IonCHLORIDE ION
3DMS-1Ligand/IonDIMETHYL SULFOXIDE
4EDO11Ligand/Ion1,2-ETHANEDIOL
5ZN-1Ligand/IonZINC ION
Biological Unit 3 (3, 11)
No.NameCountTypeFull Name
15TZ1Ligand/Ion2-(2-AZANYL-1,3-THIAZOL-4-YL)PYRIDINE-4-CARBOXYLIC ACID
2CL-1Ligand/IonCHLORIDE ION
3DMS1Ligand/IonDIMETHYL SULFOXIDE
4EDO9Ligand/Ion1,2-ETHANEDIOL
5ZN-1Ligand/IonZINC ION
Biological Unit 4 (3, 12)
No.NameCountTypeFull Name
15TZ1Ligand/Ion2-(2-AZANYL-1,3-THIAZOL-4-YL)PYRIDINE-4-CARBOXYLIC ACID
2CL-1Ligand/IonCHLORIDE ION
3DMS1Ligand/IonDIMETHYL SULFOXIDE
4EDO10Ligand/Ion1,2-ETHANEDIOL
5ZN-1Ligand/IonZINC ION

(-) Sites  (53, 53)

Asymmetric Unit (53, 53)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:188 , GLU A:190 , HIS A:276 , 5TZ A:403 , HOH A:526binding site for residue ZN A 401
02AC2SOFTWARECYS A:234 , HIS A:240 , CYS A:306 , CYS A:308binding site for residue ZN A 402
03AC3SOFTWARETYR A:132 , TYR A:177 , PHE A:185 , HIS A:188 , GLU A:190 , LYS A:206 , TRP A:208 , LYS A:241 , HIS A:276 , ZN A:401 , HOH A:502 , HOH A:526 , HOH A:533 , HOH A:614binding site for residue 5TZ A 403
04AC4SOFTWAREGLY A:170 , TYR A:177 , GLU A:190 , SER A:196 , SER A:288 , THR A:289 , ASN A:290binding site for residue EDO A 404
05AC5SOFTWARETHR A:83 , PHE A:227 , SER A:230 , THR A:243binding site for residue EDO A 405
06AC6SOFTWAREPRO A:247 , LEU A:248binding site for residue EDO A 406
07AC7SOFTWARELEU A:65 , GLY A:138 , THR A:139binding site for residue EDO A 407
08AC8SOFTWAREILE A:150 , GLY A:151 , ARG A:152 , LEU A:153 , ASN A:290 , HOH A:534binding site for residue EDO A 408
09AC9SOFTWAREASN A:9 , PRO A:10 , SER A:11 , ALA A:12 , ARG A:13binding site for residue EDO A 409
10AD1SOFTWARESER A:11 , ALA A:12 , ARG A:13 , PHE A:257 , ASP A:258binding site for residue EDO A 410
11AD2SOFTWARETYR A:59 , ARG A:98 , PHE A:202 , PHE A:283binding site for residue DMS A 411
12AD3SOFTWARELYS A:217 , TYR A:273binding site for residue DMS A 412
13AD4SOFTWAREHIS B:188 , GLU B:190 , HIS B:276 , 5TZ B:403 , HOH B:574binding site for residue ZN B 401
14AD5SOFTWARECYS B:234 , HIS B:240 , CYS B:306 , CYS B:308binding site for residue ZN B 402
15AD6SOFTWARETYR B:132 , TYR B:177 , PHE B:185 , HIS B:188 , GLU B:190 , LYS B:206 , TRP B:208 , HIS B:276 , ZN B:401 , HOH B:501 , HOH B:550 , HOH B:561 , HOH B:574 , HOH B:666binding site for residue 5TZ B 403
16AD7SOFTWAREGLY B:170 , TYR B:177 , GLU B:190 , SER B:288 , ASN B:290binding site for residue EDO B 404
17AD8SOFTWAREASN B:9 , PRO B:10 , SER B:11 , HOH B:603binding site for residue EDO B 405
18AD9SOFTWAREPRO B:10 , ALA B:12 , GLU B:214 , HIS B:215 , HOH B:559binding site for residue EDO B 406
19AE1SOFTWARESER B:11 , ALA B:12 , ARG B:13 , PRO B:212 , PHE B:257 , ASP B:258 , HOH B:539binding site for residue EDO B 407
20AE2SOFTWAREPRO B:256 , PHE B:257 , HOH B:527binding site for residue EDO B 408
21AE3SOFTWARELEU B:65 , GLY B:138 , THR B:139binding site for residue EDO B 409
22AE4SOFTWARETHR B:83 , PHE B:227 , SER B:230 , THR B:243binding site for residue EDO B 410
23AE5SOFTWARETRP B:122 , LEU B:248binding site for residue EDO B 411
24AE6SOFTWAREILE B:150 , GLY B:151 , ARG B:152 , LEU B:153 , ASN B:290 , HOH B:507binding site for residue EDO B 412
25AE7SOFTWAREASN B:9 , GLN B:37 , HOH B:512binding site for residue EDO B 413
26AE8SOFTWAREGLU B:23 , ARG B:29 , TYR B:33 , PHE B:353 , HOH B:635binding site for residue EDO B 414
27AE9SOFTWAREHIS C:188 , GLU C:190 , HIS C:276 , 5TZ C:403 , HOH C:583binding site for residue ZN C 401
28AF1SOFTWARECYS C:234 , HIS C:240 , CYS C:306 , CYS C:308binding site for residue ZN C 402
29AF2SOFTWARETYR C:132 , TYR C:177 , PHE C:185 , HIS C:188 , GLU C:190 , LYS C:206 , TRP C:208 , LYS C:241 , HIS C:276 , ZN C:401 , EDO C:404 , HOH C:503 , HOH C:571 , HOH C:581 , HOH C:583binding site for residue 5TZ C 403
30AF3SOFTWAREGLY C:170 , TYR C:177 , GLU C:190 , SER C:288 , THR C:289 , ASN C:290 , 5TZ C:403binding site for residue EDO C 404
31AF4SOFTWARETHR C:83 , PHE C:227 , THR C:243 , HOH C:616binding site for residue EDO C 405
32AF5SOFTWAREHOH C:552 , HOH C:559binding site for residue EDO C 406
33AF6SOFTWARELEU C:65 , GLY C:138 , THR C:139binding site for residue EDO C 407
34AF7SOFTWARESER C:11 , ALA C:12 , ARG C:13 , PRO C:212 , PHE C:257 , ASP C:258 , HOH C:539binding site for residue EDO C 408
35AF8SOFTWAREGLU C:23 , TYR C:30 , TYR C:33 , HOH C:531binding site for residue EDO C 409
36AF9SOFTWARELYS C:105 , TYR C:106 , CYS C:107 , HOH C:592binding site for residue EDO C 410
37AG1SOFTWAREILE C:150 , ARG C:152 , LEU C:153 , ASP C:158 , ASN C:290 , HOH C:525binding site for residue EDO C 411
38AG2SOFTWAREGLU C:298 , THR C:339 , VAL C:340 , ASP C:342 , HOH C:585binding site for residue EDO C 412
39AG3SOFTWARETYR C:59 , ARG C:98binding site for residue DMS C 413
40AG4SOFTWAREHIS D:188 , GLU D:190 , HIS D:276 , 5TZ D:403 , HOH D:629binding site for residue ZN D 401
41AG5SOFTWARECYS D:234 , HIS D:240 , CYS D:306 , CYS D:308binding site for residue ZN D 402
42AG6SOFTWARETYR D:132 , TYR D:177 , PHE D:185 , HIS D:188 , GLU D:190 , LYS D:206 , TRP D:208 , HIS D:276 , ZN D:401 , HOH D:628 , HOH D:629 , HOH D:660binding site for residue 5TZ D 403
43AG7SOFTWAREGLY D:170 , TYR D:177 , GLU D:190 , SER D:288 , THR D:289 , ASN D:290binding site for residue EDO D 405
44AG8SOFTWAREGLU D:220 , LYS D:224 , ALA D:236 , PHE D:237 , LEU D:238 , TYR D:275 , HOH D:520 , HOH D:590binding site for residue EDO D 406
45AG9SOFTWAREHIS D:201 , PHE D:202binding site for residue EDO D 407
46AH1SOFTWARETHR D:83 , SER D:230 , PHE D:237 , THR D:243binding site for residue EDO D 408
47AH2SOFTWAREGLU D:118 , TRP D:122 , LEU D:248 , HOH D:563binding site for residue EDO D 409
48AH3SOFTWARESER D:11 , ALA D:12 , ARG D:13 , PRO D:212 , PHE D:257 , ASP D:258 , HOH D:517binding site for residue EDO D 410
49AH4SOFTWARESER D:11 , ALA D:12 , GLU D:214 , HIS D:215binding site for residue EDO D 411
50AH5SOFTWARELYS D:251 , GLY D:254 , ILE D:255 , PHE D:257 , EDO D:414binding site for residue EDO D 412
51AH6SOFTWAREGLU A:161 , LYS A:162 , ARG D:56 , ASP D:61 , LEU D:65binding site for residue EDO D 413
52AH7SOFTWAREPRO D:256 , PHE D:257 , EDO D:412binding site for residue EDO D 414
53AH8SOFTWARETYR D:59 , ARG D:98binding site for residue DMS D 415

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5F2S)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5F2S)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5F2S)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5F2S)

(-) Exons   (0, 0)

(no "Exon" information available for 5F2S)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:342
                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eee..hhhhhhhhhhhhhhhhhhhhhhh.eeee..................ee...eeeeeeee..eeeeeeee...eehhhhhhhhh..........hhhhhhhhhhhhh.....eeeeeee.................hhhhhhhhhhh.........eeeee....eeeee.hhhhheeeeeeeee..eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhhh.eeehhhhhhhh....eeeee....eeee....eeeeee...eeeeeeee...hhhhhhhhh.........hhhhhhhhh..hhhhhhh............hhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5f2s A   9 NPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL 354
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308|      322       332       342       352  
                                                                                                                                                                                                                                                                                                                                     308|                                         
                                                                                                                                                                                                                                                                                                                                      313                                         


Chain B from PDB  Type:PROTEIN  Length:352
                                                                                                                                                                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh......eee........hhhhhhhhhhhhhhhhh.eeee..................ee...eeeeeeee..eeeeeeee...eehhhhhhhhhh.........hhhhhhhhhhhhh.....eeeeeee.................hhhhhhhhhhh.........eeeee....eeeee.hhhhheeeeeeeee..eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhhh.eeehhhhhhhh....eeeee....eeee....eeeeee...eeeeeeee...hhhhhhhhh...........hhhhhhhhh..hhhhhhh............hhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5f2s B   1 MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL 354
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       312       322       332       342       352  
                                                                                                                                                                                                                                                                                                                                              309|                                          
                                                                                                                                                                                                                                                                                                                                               312                                          


Chain C from PDB  Type:PROTEIN  Length:347
                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee..hhhhhhhhhhhhhhhhhhhhhhh.eeee..................ee...eeeeeeee..eeeeeeee...eehhhhhhhhhh.........hhhhhhhhhhhhh.....eeeeeee.................hhhhhhhhh...........eeeee....eeeee.hhhhheeeeeeeee..eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhhh.eeehhhhhhhh....eeeee....eeee....eeeeee...eeeeeeee...hhhhhhhhh.............hhhhhhhhh..hhhhhhh............hhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5f2s C   7 TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEF 353
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       


Chain D from PDB  Type:PROTEIN  Length:349
                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........ee..hhhhhhhhhhhhhhhhhhhhhhh.eeee..................ee...eeeeeeee..eeeeeeee...eehhhhhhhhhh.........hhhhhhhhhhhhh.....eeeeeee.................hhhhhhhhh...........eeeee....eeeee.hhhhheeeeeeeee..eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhhh.eeehhhhhhhh....eeeee....eeee....eeeeee...eeeeeeee...hhhhhhhhh.............hhhhhhhhh..hhhhhhh............hhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5f2s D   6 ETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL 354
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5F2S)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5F2S)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5F2S)

(-) Gene Ontology  (25, 25)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5TZ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DMS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
    AG6  [ RasMol ]  +environment [ RasMol ]
    AG7  [ RasMol ]  +environment [ RasMol ]
    AG8  [ RasMol ]  +environment [ RasMol ]
    AG9  [ RasMol ]  +environment [ RasMol ]
    AH1  [ RasMol ]  +environment [ RasMol ]
    AH2  [ RasMol ]  +environment [ RasMol ]
    AH3  [ RasMol ]  +environment [ RasMol ]
    AH4  [ RasMol ]  +environment [ RasMol ]
    AH5  [ RasMol ]  +environment [ RasMol ]
    AH6  [ RasMol ]  +environment [ RasMol ]
    AH7  [ RasMol ]  +environment [ RasMol ]
    AH8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5f2s)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5f2s
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KDM4A_HUMAN | O75164
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.14.11.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  KDM4A_HUMAN | O75164
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KDM4A_HUMAN | O75164: 2gf7 2gfa 2gp3 2gp5 2oq6 2oq7 2os2 2ot7 2ox0 2p5b 2pxj 2q8c 2q8d 2q8e 2qqr 2qqs 2vd7 2wwj 2ybk 2ybp 2ybs 3njy 3pdq 3rvh 3u4s 4ai9 4bis 4gd4 4ura 4v2v 4v2w 5a7n 5a7o 5a7p 5a7q 5a7s 5a7w 5a80 5anq 5d6w 5d6x 5d6y 5f2w 5f32 5f37 5f39 5f3c 5f3e 5f3g 5f3i 5f5i 5fpv 5fwe 5fy8 5fyc 5fyh 5fyi 5ly1 5ly2 5tvr 5tvs

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5F2S)