Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN KDM4A IN COMPLEX WITH COMPOUND 58
 
Authors :  Y. -V. Le Bihan, S. Dempster, I. M. Westwood, R. L. M. Van Montfort
Date :  02 Dec 15  (Deposition) - 20 Jan 16  (Release) - 09 Mar 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.22
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Epigenetics, Demethylase, Inhibitor, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  V. Bavetsias, R. M. Lanigan, G. F. Ruda, B. Atrash, M. G. Mclaughlin, A. Tumber, N. Y. Mok, Y. V. Le Bihan, S. Dempster, K. J. Boxall, F. Jeganathan, S. B. Hatch, P. Savitsky, S. Velupillai, T. Krojer, K. S. England, J. Sejberg, C. Thai, A. Donovan, A. Pal, G. Scozzafava, J. M. Bennett, A. Kawamura, C. Johansson, A. Szykowska, C. Gileadi, N. A. Burgess-Brown, F. Von Delft, U. Oppermann, Z. Walters, J. Shipley, F. I. Raynaud, S. M. Westaway, R. K. Prinjha, O. Fedorov, R. Burke, C. J. Schofield, I. M. Westwood, C. Bountra, S. Muller, R. L. Van Montfort, P. E. Brennan, J. Blagg
8-Substituted Pyrido[3, 4-D]Pyrimidin-4(3H)-One Derivatives As Potent, Cell Permeable, Kdm4 (Jmjd2) And Kdm5 (Jarid1) Histone Lysine Demethylase Inhibitors.
J. Med. Chem. V. 59 1388 2016
PubMed-ID: 26741168  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.5B01635

(-) Compounds

Molecule 1 - LYSINE-SPECIFIC DEMETHYLASE 4A
    Chains: A, B, C, D
    EC Number: 1.14.11.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PNIC28
    Expression System Taxid: 469008
    Expression System Variant: ROSETTA 2
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 1-359
    Gene: KDM4A, JHDM3A, JMJD2, JMJD2A, KIAA0677
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: JMJC DOMAIN-CONTAINING HISTONE DEMETHYLATION PROTEIN 3A, JUMONJI DOMAIN-CONTAINING PROTEIN 2A

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A   
Biological Unit 2 (1x):  B  
Biological Unit 3 (1x):   C 
Biological Unit 4 (1x):    D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 60)

Asymmetric Unit (4, 60)
No.NameCountTypeFull Name
1DMS5Ligand/IonDIMETHYL SULFOXIDE
2EDO43Ligand/Ion1,2-ETHANEDIOL
3N5J4Ligand/Ion3H-PYRIDO[3,4-D]PYRIMIDIN-4-ONE
4ZN8Ligand/IonZINC ION
Biological Unit 1 (3, 15)
No.NameCountTypeFull Name
1DMS2Ligand/IonDIMETHYL SULFOXIDE
2EDO12Ligand/Ion1,2-ETHANEDIOL
3N5J1Ligand/Ion3H-PYRIDO[3,4-D]PYRIMIDIN-4-ONE
4ZN-1Ligand/IonZINC ION
Biological Unit 2 (3, 16)
No.NameCountTypeFull Name
1DMS1Ligand/IonDIMETHYL SULFOXIDE
2EDO14Ligand/Ion1,2-ETHANEDIOL
3N5J1Ligand/Ion3H-PYRIDO[3,4-D]PYRIMIDIN-4-ONE
4ZN-1Ligand/IonZINC ION
Biological Unit 3 (3, 9)
No.NameCountTypeFull Name
1DMS1Ligand/IonDIMETHYL SULFOXIDE
2EDO7Ligand/Ion1,2-ETHANEDIOL
3N5J1Ligand/Ion3H-PYRIDO[3,4-D]PYRIMIDIN-4-ONE
4ZN-1Ligand/IonZINC ION
Biological Unit 4 (3, 12)
No.NameCountTypeFull Name
1DMS1Ligand/IonDIMETHYL SULFOXIDE
2EDO10Ligand/Ion1,2-ETHANEDIOL
3N5J1Ligand/Ion3H-PYRIDO[3,4-D]PYRIMIDIN-4-ONE
4ZN-1Ligand/IonZINC ION

(-) Sites  (60, 60)

Asymmetric Unit (60, 60)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:188 , GLU A:190 , HIS A:276 , N5J A:403 , HOH A:504 , HOH A:524binding site for residue ZN A 401
02AC2SOFTWARECYS A:234 , HIS A:240 , CYS A:306 , CYS A:308binding site for residue ZN A 402
03AC3SOFTWARETYR A:132 , TYR A:177 , PHE A:185 , HIS A:188 , ASN A:198 , LYS A:206 , TRP A:208 , LYS A:241 , HIS A:276 , ZN A:401 , HOH A:504binding site for residue N5J A 403
04AC4SOFTWAREGLY A:170 , GLU A:190 , SER A:288 , THR A:289 , ASN A:290 , HOH A:524binding site for residue EDO A 404
05AC5SOFTWARETHR A:83 , SER A:230 , HIS A:240 , MET A:242 , THR A:243binding site for residue EDO A 405
06AC6SOFTWARELEU A:65 , GLY A:138 , THR A:139binding site for residue EDO A 406
07AC7SOFTWAREILE A:150 , GLY A:151 , LEU A:153 , ASN A:290 , HOH A:506binding site for residue EDO A 407
08AC8SOFTWAREASN A:9 , PRO A:10 , SER A:11 , ALA A:12binding site for residue EDO A 408
09AC9SOFTWARESER A:11 , ALA A:12 , ARG A:13 , PRO A:212 , PHE A:257 , ASP A:258 , HOH A:546binding site for residue EDO A 409
10AD1SOFTWAREALA A:134 , ASP A:135 , LYS A:241 , HOH A:503binding site for residue EDO A 410
11AD2SOFTWAREPRO A:50 , LYS A:51 , TRP A:53 , TYR A:199 , EDO A:415binding site for residue EDO A 411
12AD3SOFTWAREGLU A:235 , ALA A:236 , PHE A:237 , LEU A:238binding site for residue EDO A 412
13AD4SOFTWARELYS A:251 , GLY A:254 , ILE A:255 , PHE A:257 , EDO A:414binding site for residue EDO A 413
14AD5SOFTWAREPHE A:257 , EDO A:413binding site for residue EDO A 414
15AD6SOFTWAREHIS A:201 , EDO A:411binding site for residue EDO A 415
16AD7SOFTWARETYR A:59 , ARG A:98 , PHE A:202binding site for residue DMS A 416
17AD8SOFTWARELYS A:54 , PRO A:55 , ARG A:56 , ALA A:57 , GLU A:142 , HIS A:144binding site for residue DMS A 417
18AD9SOFTWAREHIS B:188 , GLU B:190 , HIS B:276 , N5J B:403 , HOH B:540 , HOH B:545binding site for residue ZN B 401
19AE1SOFTWARECYS B:234 , HIS B:240 , CYS B:306 , CYS B:308binding site for residue ZN B 402
20AE2SOFTWARETYR B:132 , TYR B:177 , PHE B:185 , HIS B:188 , ASN B:198 , LYS B:206 , TRP B:208 , LYS B:241 , HIS B:276 , ZN B:401 , HOH B:545binding site for residue N5J B 403
21AE3SOFTWAREGLY B:170 , GLU B:190 , SER B:288 , THR B:289 , HOH B:540binding site for residue EDO B 404
22AE4SOFTWAREASN B:9 , PRO B:10 , SER B:11binding site for residue EDO B 405
23AE5SOFTWAREPRO B:10 , ALA B:12 , GLU B:214 , HIS B:215binding site for residue EDO B 406
24AE6SOFTWARESER B:11 , ALA B:12 , ARG B:13 , PRO B:212 , PHE B:257 , ASP B:258 , HOH B:578binding site for residue EDO B 407
25AE7SOFTWAREPRO B:256 , PHE B:257 , EDO B:417binding site for residue EDO B 408
26AE8SOFTWARELEU B:65 , GLY B:138 , THR B:139binding site for residue EDO B 409
27AE9SOFTWARETHR B:83 , PHE B:227 , SER B:230 , HIS B:240 , THR B:243binding site for residue EDO B 410
28AF1SOFTWAREILE B:150 , GLY B:151 , ARG B:152 , LEU B:153 , ASN B:290 , HOH B:520binding site for residue EDO B 411
29AF2SOFTWARELEU B:8 , ASN B:9 , GLN B:37binding site for residue EDO B 412
30AF3SOFTWAREGLU B:23 , ARG B:29 , HOH B:583binding site for residue EDO B 413
31AF4SOFTWAREASN B:86 , ALA B:134 , ASP B:135 , SER B:184 , LYS B:241 , HOH B:507 , HOH B:628binding site for residue EDO B 414
32AF5SOFTWAREHIS B:188 , THR B:189 , ASP B:191 , ARG B:239 , HOH B:598binding site for residue EDO B 415
33AF6SOFTWARELYS B:224 , GLU B:235 , ALA B:236 , PHE B:237 , LEU B:238 , HOH B:591binding site for residue EDO B 416
34AF7SOFTWARELYS B:251 , GLY B:254 , ILE B:255 , PRO B:256 , EDO B:408binding site for residue EDO B 417
35AF8SOFTWAREGLN B:88binding site for residue DMS B 418
36AF9SOFTWAREHIS C:188 , GLU C:190 , HIS C:276 , N5J C:403 , HOH C:536 , HOH C:561binding site for residue ZN C 401
37AG1SOFTWARECYS C:234 , HIS C:240 , CYS C:306 , CYS C:308binding site for residue ZN C 402
38AG2SOFTWARETYR C:132 , TYR C:177 , PHE C:185 , HIS C:188 , LYS C:206 , LYS C:241 , HIS C:276 , ZN C:401 , EDO C:410 , HOH C:536 , HOH C:561binding site for residue N5J C 403
39AG3SOFTWAREGLY C:170 , TYR C:177 , GLU C:190 , SER C:288 , THR C:289 , HOH C:536binding site for residue EDO C 404
40AG4SOFTWARETHR C:83 , PHE C:227 , THR C:243binding site for residue EDO C 405
41AG5SOFTWAREGLY C:138 , THR C:139binding site for residue EDO C 406
42AG6SOFTWARESER C:11 , ALA C:12 , ARG C:13 , PRO C:212 , PHE C:257 , ASP C:258 , HOH C:531 , HOH C:556binding site for residue EDO C 407
43AG7SOFTWAREGLU C:23 , TYR C:30 , HOH C:527binding site for residue EDO C 408
44AG8SOFTWAREILE C:150 , GLY C:151 , ARG C:152 , LEU C:153 , ASN C:290 , HOH C:511binding site for residue EDO C 409
45AG9SOFTWAREALA C:134 , ASP C:135 , LYS C:241 , N5J C:403 , HOH C:515binding site for residue EDO C 410
46AH1SOFTWARETYR C:59 , ILE C:62 , ARG C:98binding site for residue DMS C 411
47AH2SOFTWAREHIS D:188 , GLU D:190 , HIS D:276 , N5J D:403 , HOH D:528 , HOH D:530binding site for residue ZN D 401
48AH3SOFTWARECYS D:234 , HIS D:240 , CYS D:306 , CYS D:308binding site for residue ZN D 402
49AH4SOFTWARETYR D:132 , TYR D:177 , PHE D:185 , HIS D:188 , ASN D:198 , LYS D:206 , TRP D:208 , LYS D:241 , HIS D:276 , ZN D:401 , HOH D:528 , HOH D:530binding site for residue N5J D 403
50AH5SOFTWARELYS D:224 , GLU D:235 , ALA D:236 , PHE D:237 , LEU D:238 , HOH D:519 , HOH D:601binding site for residue EDO D 404
51AH6SOFTWAREHIS D:201binding site for residue EDO D 405
52AH7SOFTWARETHR D:83 , PHE D:227 , SER D:230 , PHE D:237 , THR D:243 , HOH D:598binding site for residue EDO D 406
53AH8SOFTWARESER D:11 , ALA D:12 , ARG D:13 , PRO D:212 , PHE D:257 , ASP D:258 , HOH D:564binding site for residue EDO D 407
54AH9SOFTWARESER D:11 , GLU D:214 , HIS D:215 , HOH D:623binding site for residue EDO D 408
55AI1SOFTWARELYS D:251 , GLY D:254 , ILE D:255 , EDO D:411binding site for residue EDO D 409
56AI2SOFTWAREGLU A:161 , LYS A:162 , ARG D:56 , ASP D:61binding site for residue EDO D 410
57AI3SOFTWAREPHE D:257 , EDO D:409binding site for residue EDO D 411
58AI4SOFTWAREGLU D:23 , ARG D:29 , PHE D:353 , HOH D:520binding site for residue EDO D 412
59AI5SOFTWAREALA D:134 , ASP D:135 , SER D:184 , LYS D:241 , HOH D:545 , HOH D:560binding site for residue EDO D 413
60AI6SOFTWARETYR D:59 , ARG D:98binding site for residue DMS D 414

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5F37)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5F37)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5F37)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5F37)

(-) Exons   (0, 0)

(no "Exon" information available for 5F37)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:350
                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eee..hhhhhhhhhhhhhhhhhhhhhhh.eeee..................ee...eeeeeeee..eeeeeeee...eehhhhhhhhh..........hhhhhhhhhhhhh.....eeeeeee...........hhhhh.hhhhhhhhhhh.........eeeee....eeeee.hhhhheeeeeeeee..eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhhh.eeehhhhhhhh....eeeee....eeee....eeeeee...eeeeeeee...hhhhhhhhh.............hhhhhhhhh..hhhhhhh............hhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5f37 A   5 SETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL 354
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354


Chain B from PDB  Type:PROTEIN  Length:354
                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhh......eee..hhhhhhhhhhhhhhhhhhhhhhh.eeee..................ee...eeeeeeee..eeeeeeee...eehhhhhhhhh..........hhhhhhhhhhhhh.....eeeeeee.................hhhhhhhhhhh.........eeeee....eeeee.hhhhheeeeeeeee..eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhhh.eeehhhhhhhh....eeeee....eeee....eeeeee...eeeeeeee...hhhhhhhhh.............hhhhhhhhh..hhhhhhh............hhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5f37 B   1 MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL 354
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350    


Chain C from PDB  Type:PROTEIN  Length:349
                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eee..hhhhhhhhhhhhhhhhhhhhhhh.eeee..................ee...eeeeeeee..eeeeeeee...eehhhhhhhhh..........hhhhhhhhhhhhh.....eeeeeee.................hhhhhhhhhhh.........eeeee....eeeee.hhhhheeeeeeeee..eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhhh.eeehhhhhhhh....eeeee....eeee....eeeeee...eeeeeeee...hhhhhhhhh.............hhhhhhhhh..hhhhhhh............hhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5f37 C   6 ETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL 354
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345         


Chain D from PDB  Type:PROTEIN  Length:350
                                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eee..hhhhhhhhhhhhhhhhhhhhhhh.eeee..................ee...eeeeeeee..eeeeeeee...eehhhhhhhhh..........hhhhhhhhhhhhh.....eeeeeee...........hhhhh.hhhhhhhhhhh.........eeeee....eeeee.hhhhheeeeeeeee..eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhhh.eeehhhhhhhh....eeeee....eeee....eeeeee...eeeeeeee...hhhhhhhhh.............hhhhhhhhh..hhhhhhh............hhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5f37 D   5 SETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL 354
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5F37)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5F37)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5F37)

(-) Gene Ontology  (25, 25)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DMS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    N5J  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
    AG6  [ RasMol ]  +environment [ RasMol ]
    AG7  [ RasMol ]  +environment [ RasMol ]
    AG8  [ RasMol ]  +environment [ RasMol ]
    AG9  [ RasMol ]  +environment [ RasMol ]
    AH1  [ RasMol ]  +environment [ RasMol ]
    AH2  [ RasMol ]  +environment [ RasMol ]
    AH3  [ RasMol ]  +environment [ RasMol ]
    AH4  [ RasMol ]  +environment [ RasMol ]
    AH5  [ RasMol ]  +environment [ RasMol ]
    AH6  [ RasMol ]  +environment [ RasMol ]
    AH7  [ RasMol ]  +environment [ RasMol ]
    AH8  [ RasMol ]  +environment [ RasMol ]
    AH9  [ RasMol ]  +environment [ RasMol ]
    AI1  [ RasMol ]  +environment [ RasMol ]
    AI2  [ RasMol ]  +environment [ RasMol ]
    AI3  [ RasMol ]  +environment [ RasMol ]
    AI4  [ RasMol ]  +environment [ RasMol ]
    AI5  [ RasMol ]  +environment [ RasMol ]
    AI6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5f37)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5f37
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KDM4A_HUMAN | O75164
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.14.11.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  KDM4A_HUMAN | O75164
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KDM4A_HUMAN | O75164: 2gf7 2gfa 2gp3 2gp5 2oq6 2oq7 2os2 2ot7 2ox0 2p5b 2pxj 2q8c 2q8d 2q8e 2qqr 2qqs 2vd7 2wwj 2ybk 2ybp 2ybs 3njy 3pdq 3rvh 3u4s 4ai9 4bis 4gd4 4ura 4v2v 4v2w 5a7n 5a7o 5a7p 5a7q 5a7s 5a7w 5a80 5anq 5d6w 5d6x 5d6y 5f2s 5f2w 5f32 5f39 5f3c 5f3e 5f3g 5f3i 5f5i 5fpv 5fwe 5fy8 5fyc 5fyh 5fyi 5ly1 5ly2 5tvr 5tvs

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5F37)