Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  QUADRUPLE SPACE GROUP AMBIGUITY DUE TO ROTATIONAL AND TRANSLATIONAL NON-CRYSTALLOGRAPHIC SYMMETRY IN HUMAN LIVER FRUCTOSE-1,6-BISPHOSPHATASE
 
Authors :  A. Ruf, T. Tetaz, B. Schott, C. Joseph, M. G. Rudolph
Date :  29 Jun 16  (Deposition) - 26 Oct 16  (Release) - 09 Nov 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,B,C,D  (1x)
Biol. Unit 2:  E,F  (2x)
Keywords :  Phosphoric Monoester, Allosteric Enzyme, Carbohydrate, Metabolism, Gluconeogenesis, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Ruf, T. Tetaz, B. Schott, C. Joseph, M. G. Rudolph
Quadruple Space Group Ambiguity Due To Rotational And Translational Non-Crystallographic Symmetry In Human Liver Fructose-1, 6-Bisphosphatase
Acta Crystallogr. , Sect. D V. 72 1212 2016
PubMed: search  |  Reference-DOI: 10.1107/S2059798316016715

(-) Compounds

Molecule 1 - FRUCTOSE-1,6-BISPHOSPHATASE 1
    Chains: A, B, C, D, E, F
    EC Number: 3.1.3.11
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: FBP1, FBP
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: FBPASE 1,D-FRUCTOSE-1,6-BISPHOSPHATE 1-PHOSPHOHYDROLASE 1, LIVER FBPASE

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEF
Biological Unit 1 (1x): ABCD  
Biological Unit 2 (2x):     EF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 41)

Asymmetric Unit (3, 41)
No.NameCountTypeFull Name
1CL3Ligand/IonCHLORIDE ION
2SO429Ligand/IonSULFATE ION
3ZN9Ligand/IonZINC ION
Biological Unit 1 (1, 20)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2SO420Ligand/IonSULFATE ION
3ZN-1Ligand/IonZINC ION
Biological Unit 2 (1, 18)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2SO418Ligand/IonSULFATE ION
3ZN-1Ligand/IonZINC ION

(-) Sites  (41, 41)

Asymmetric Unit (41, 41)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLU A:98 , ASP A:119 , ASP A:122 , GLU A:281 , HOH A:501binding site for residue ZN A 401
02AC2SOFTWAREGLU A:226 , HIS A:335 , HOH A:570 , HIS B:335binding site for residue ZN A 402
03AC3SOFTWAREASP A:122 , GLY A:123 , SER A:124 , SER A:125 , HOH A:501binding site for residue SO4 A 403
04AC4SOFTWARELYS A:275 , ARG A:277 , ARG A:314binding site for residue SO4 A 404
05AC5SOFTWAREASN A:213 , TYR A:245 , TYR A:265 , HOH A:559 , ARG B:244 , SO4 B:408binding site for residue SO4 A 405
06AC6SOFTWARETHR A:28 , GLY A:29 , GLU A:30 , LEU A:31 , LYS A:113 , TYR A:114 , HOH A:555binding site for residue SO4 A 406
07AC7SOFTWAREGLU B:98 , ASP B:119 , ASP B:122 , GLU B:281 , HOH B:505binding site for residue ZN B 401
08AC8SOFTWAREASP B:122 , GLY B:123 , SER B:124 , SER B:125 , HOH B:505binding site for residue SO4 B 402
09AC9SOFTWARELYS B:275 , ARG B:277 , ARG B:314binding site for residue SO4 B 403
10AD1SOFTWAREARG A:244 , ASN B:213 , TYR B:245 , TYR B:265 , LYS B:275 , HOH B:540binding site for residue SO4 B 404
11AD2SOFTWAREGLY B:27 , THR B:28 , GLY B:29 , GLU B:30 , LEU B:31 , LYS B:113 , TYR B:114 , HOH B:560binding site for residue SO4 B 405
12AD3SOFTWAREARG B:277 , ARG B:314binding site for residue SO4 B 406
13AD4SOFTWARELYS B:142 , LYS B:143 , SER B:144 , THR B:145 , ASP B:152binding site for residue SO4 B 407
14AD5SOFTWAREASN A:213 , TYR A:216 , SO4 A:405 , GLY B:242 , ARG B:244binding site for residue SO4 B 408
15AD6SOFTWARELYS B:205binding site for residue CL B 409
16AD7SOFTWAREGLU C:98 , ASP C:119 , ASP C:122 , GLU C:281 , HOH C:504binding site for residue ZN C 401
17AD8SOFTWAREASP C:122 , GLY C:123 , SER C:124 , SER C:125 , HOH C:504binding site for residue SO4 C 402
18AD9SOFTWARELYS C:275 , ARG C:277 , ARG C:314 , HOH C:511binding site for residue SO4 C 403
19AE1SOFTWAREASN C:213 , TYR C:216 , TYR C:245 , TYR C:265 , LYS C:275 , HOH C:514 , ARG D:244binding site for residue SO4 C 404
20AE2SOFTWARETHR C:28 , GLY C:29 , GLU C:30 , LEU C:31 , LYS C:113 , TYR C:114binding site for residue SO4 C 405
21AE3SOFTWAREARG C:277 , ARG C:314binding site for residue SO4 C 406
22AE4SOFTWAREGLU D:98 , ASP D:119 , ASP D:122 , GLU D:281 , HOH D:502binding site for residue ZN D 401
23AE5SOFTWAREGLU D:226 , HIS D:335 , HOH D:578 , HIS F:335binding site for residue ZN D 402
24AE6SOFTWAREASP D:122 , GLY D:123 , SER D:124 , SER D:125 , HOH D:502 , HOH D:515binding site for residue SO4 D 403
25AE7SOFTWARELYS D:275 , ARG D:277 , ARG D:314binding site for residue SO4 D 404
26AE8SOFTWAREARG C:244 , ASN D:213 , TYR D:245 , TYR D:265 , HOH D:513binding site for residue SO4 D 405
27AE9SOFTWAREGLY D:27 , THR D:28 , GLY D:29 , GLU D:30 , LEU D:31 , TYR D:114 , HOH D:521binding site for residue SO4 D 406
28AF1SOFTWARELYS D:205 , HOH D:573binding site for residue CL D 407
29AF2SOFTWAREGLU E:98 , ASP E:119 , ASP E:122 , GLU E:281 , HOH E:501binding site for residue ZN E 401
30AF3SOFTWAREPRO C:222 , HIS C:335 , GLU E:226 , HIS E:335 , HOH E:577binding site for residue ZN E 402
31AF4SOFTWAREASP E:122 , GLY E:123 , SER E:124 , SER E:125 , HOH E:501 , HOH E:525binding site for residue SO4 E 403
32AF5SOFTWARELYS E:275 , ARG E:277 , ARG E:314binding site for residue SO4 E 404
33AF6SOFTWAREASN E:213 , TYR E:216 , TYR E:245 , TYR E:265 , LYS E:275 , ARG F:244 , HOH F:543binding site for residue SO4 E 405
34AF7SOFTWARETHR E:28 , GLY E:29 , GLU E:30 , LEU E:31 , LYS E:113 , TYR E:114binding site for residue SO4 E 406
35AF8SOFTWAREGLU F:98 , ASP F:119 , ASP F:122 , GLU F:281 , HOH F:502binding site for residue ZN F 401
36AF9SOFTWAREASP F:122 , GLY F:123 , SER F:124 , SER F:125 , HOH F:502binding site for residue SO4 F 402
37AG1SOFTWARELYS F:275 , ARG F:277 , ARG F:314binding site for residue SO4 F 403
38AG2SOFTWAREARG E:244 , ASN F:213 , TYR F:216 , TYR F:245 , TYR F:265 , HOH F:521binding site for residue SO4 F 404
39AG3SOFTWAREGLY F:27 , THR F:28 , GLY F:29 , GLU F:30 , LEU F:31 , LYS F:113 , TYR F:114 , HOH F:534binding site for residue SO4 F 405
40AG4SOFTWAREARG F:277 , ARG F:314binding site for residue SO4 F 406
41AG5SOFTWARELYS F:205binding site for residue CL F 407

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5LDZ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5LDZ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5LDZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5LDZ)

(-) Exons   (0, 0)

(no "Exon" information available for 5LDZ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:311
                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..eeeeee......ee.hhhhh..eeeeeeeeehhhhhhhh..eeeeeeeee.......hhhhhh.hhhhh.eeeeeee...eeeeeee..eeeeeeee....eeeeee..........eee.hhhhhhhhhhhhhhhhhhhhh........ee....hhhhhhhhhhhhh.eeee...............hhhhhhhhhhhh..eee....hhhhh..........eeeehhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ldz A   6 PFDTDVNTLTRFVMEEGTGELTQLLNSLCTAVKAISSAVRKAGIAHKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS 336
                                    15      ||30        40        50     || 75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335 
                                           22|                          56|                                                                                                                                                                                                                                                                        
                                            28                           72                                                                                                                                                                                                                                                                        


Chain B from PDB  Type:PROTEIN  Length:312
                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh..eeeeee......ee.hhhhh..eeeeeeeeehhhhhhhh..eeeeeeeee.......hhhhhh.hhhhh.eeeeeee...eeeeeee..eeeeeeee....eeeeee..........eee.hhhhhhhhhhhhhhhhhhhhh........ee....hhhhhhhhhhhhh.eeee...............hhhhhhhhhhhh..eee....hhhhh..........eeeehhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5ldz B   6 PFDTDVNTLTRFVMEEGGTGELTQLLNSLCTAVKAISSAVRKAGIAKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSA 337
                                    15      ||29        39        49     || 75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335  
                                           22|                          55|                                                                                                                                                                                                                                                                         
                                            27                           72                                                                                                                                                                                                                                                                         


Chain C from PDB  Type:PROTEIN  Length:311
                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh..eeeeee......ee.hhhhh..eeeeeeeeehhhhhhhh..eeeeeeeee.......hhhhhh.hhhhh.eeeeeee...eeeeeee..eeeeeeee....eeeeee..........eee.hhhhhhhhhhhhhhhhhhhhh........ee....hhhhhhhhhhhhh.eeee...............hhhhhhhhhhhh..eee....hhhhh..........eeeehhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ldz C   6 PFDTDVNTLTRFVMEEGTGELTQLLNSLCTAVKAISSAVRKAGIAKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSA 337
                                    15      ||30        40        50    ||  76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336 
                                           22|                         55|                                                                                                                                                                                                                                                                         
                                            28                          72                                                                                                                                                                                                                                                                         


Chain D from PDB  Type:PROTEIN  Length:313
                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..eeeeee......ee.hhh.eeeeeeeeeeeehhhhhhhh..eeeeeeeee.......hhhhhh.hhhhh.eeeeeee...eeeeeee..eeeeeeee....eeeeee..........eee.hhhhhhhhhhhhhhhhhhhhh........ee....hhhhhhhhhhhhh.eeee...............hhhhhhhhhhhh..eee....hhhhh..........eeeehhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ldz D   6 PFDTDVNTLTRFVMEEGGTGELTQLLNSLCTAVKAISSAVRKAGIAHLKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS 336
                                    15      ||29        39        49       |73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333   
                                           22|                            57|                                                                                                                                                                                                                                                                        
                                            27                             72                                                                                                                                                                                                                                                                        


Chain E from PDB  Type:PROTEIN  Length:311
                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..eeeeee......ee.hhhhh..eeeeeeeeehhhhhhhh..eeeeeeeee.......hhhhhh.hhhhh.eeeeeee...eeeeeee..eeeeeeee....eeeeee..........eee.hhhhhhhhhhhhhhhhhhhhh........ee....hhhhhhhhhhhhh.eeee...............hhhhhhhhhhhh..eee....hhhhh..........eeeehhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ldz E   6 PFDTDVNTLTRFVMEEGTGELTQLLNSLCTAVKAISSAVRKAGIAHKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS 336
                                    15      ||30        40        50     || 75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335 
                                           22|                          56|                                                                                                                                                                                                                                                                        
                                            28                           72                                                                                                                                                                                                                                                                        


Chain F from PDB  Type:PROTEIN  Length:314
                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh..eeeeee......ee.hhhhh..eeeeeeeeehhhhhhhh..eeeeeeeee.......hhhhhh.hhhhh.eeeeeee...eeeeeee..eeeeeeee....eeeeee..........eee.hhhhhhhhhhhhhhhhhhhhh........ee....hhhhhhhhhhhhh.eeee...............hhhhhhhhhhhh..eee....hhhhh..........eeeehhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ldz F   6 PFDTDVNTLTRFVMEEGGTGELTQLLNSLCTAVKAISSAVRKAGIAHLKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSA 337
                                    15      ||29        39        49       |73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333    
                                           22|                            57|                                                                                                                                                                                                                                                                         
                                            27                             72
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5LDZ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5LDZ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5LDZ)

(-) Gene Ontology  (25, 25)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5ldz)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ldz
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  F16P1_HUMAN | P09467
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.3.11
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  F16P1_HUMAN | P09467
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        F16P1_HUMAN | P09467: 1fta 2fhy 2fie 2fix 2jjk 2vt5 2wbb 2wbd 2y5k 2y5l 3a29 3kbz 3kc0 3kc1 4mjo

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5LDZ)