Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE GTPASE HETERODIMER OF CRENARCHAEAL SRP54 AND FTSY
 
Authors :  G. Bange, K. Wild, I. Sinning
Date :  24 May 16  (Deposition) - 08 Jun 16  (Release) - 20 Jul 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,F  (1x)
Biol. Unit 4:  G,H  (1x)
Keywords :  Co-Translational Protein Targeting, Signal Recognition Particle, Gtpase, Protein Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Wild, G. Bange, D. Motiejunas, J. Kribelbauer, A. Hendricks, B. Segnitz, R. C. Wade, I. Sinning
Structural Basis For Conserved Regulation And Adaptation Of The Signal Recognition Particle Targeting Complex.
J. Mol. Biol. V. 428 2880 2016
PubMed-ID: 27241309  |  Reference-DOI: 10.1016/J.JMB.2016.05.015

(-) Compounds

Molecule 1 - SIGNAL RECOGNITION PARTICLE 54 KDA PROTEIN
    Chains: A, C, E, G
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: SRP54, SSO0971
    Organism Scientific: SULFOLOBUS SOLFATARICUS (STRAIN ATCC 35092 / DSM 1617 / JCM 11322 / P2)
    Organism Taxid: 273057
    Strain: ATCC 35092 / DSM 1617 / JCM 11322 / P2
    Synonym: SRP54
 
Molecule 2 - SIGNAL RECOGNITION PARTICLE RECEPTOR FTSY
    Chains: B, D, F, H
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: FTSY, DPA, SSO, SACI_1462
    Organism Scientific: SULFOLOBUS ACIDOCALDARIUS
    Organism Taxid: 330779
    Strain: ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770
    Synonym: SRP RECEPTOR,DOCKING PROTEIN,P41

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit : ABCDEFGH
Biological Unit 1 (1x): AB      
Biological Unit 2 (1x):   CD    
Biological Unit 3 (1x):     EF  
Biological Unit 4 (1x):       GH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 47)

Asymmetric Unit (5, 47)
No.NameCountTypeFull Name
1G4Ligand/IonGUANOSINE-5'-MONOPHOSPHATE
2GNP8Ligand/IonPHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
3GOL18Ligand/IonGLYCEROL
4MG8Ligand/IonMAGNESIUM ION
5SO49Ligand/IonSULFATE ION
Biological Unit 1 (3, 14)
No.NameCountTypeFull Name
1G-1Ligand/IonGUANOSINE-5'-MONOPHOSPHATE
2GNP2Ligand/IonPHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
3GOL7Ligand/IonGLYCEROL
4MG-1Ligand/IonMAGNESIUM ION
5SO45Ligand/IonSULFATE ION
Biological Unit 2 (3, 6)
No.NameCountTypeFull Name
1G-1Ligand/IonGUANOSINE-5'-MONOPHOSPHATE
2GNP2Ligand/IonPHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
3GOL3Ligand/IonGLYCEROL
4MG-1Ligand/IonMAGNESIUM ION
5SO41Ligand/IonSULFATE ION
Biological Unit 3 (3, 6)
No.NameCountTypeFull Name
1G-1Ligand/IonGUANOSINE-5'-MONOPHOSPHATE
2GNP2Ligand/IonPHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
3GOL3Ligand/IonGLYCEROL
4MG-1Ligand/IonMAGNESIUM ION
5SO41Ligand/IonSULFATE ION
Biological Unit 4 (3, 9)
No.NameCountTypeFull Name
1G-1Ligand/IonGUANOSINE-5'-MONOPHOSPHATE
2GNP2Ligand/IonPHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
3GOL5Ligand/IonGLYCEROL
4MG-1Ligand/IonMAGNESIUM ION
5SO42Ligand/IonSULFATE ION

(-) Sites  (47, 47)

Asymmetric Unit (47, 47)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLN A:105 , GLY A:106 , SER A:107 , GLY A:108 , LYS A:109 , THR A:110 , THR A:111 , LYS A:115 , ARG A:136 , GLN A:142 , GLY A:188 , LYS A:246 , ASP A:248 , GLY A:271 , THR A:272 , GLY A:273 , GLU A:274 , MG A:302 , HOH A:429 , HOH A:439 , HOH A:443 , HOH A:453 , HOH A:472 , HOH A:477 , HOH A:489 , ASN B:182 , ARG B:213 , GNP B:401binding site for residue GNP A 301
02AC2SOFTWARETHR A:110 , GNP A:301 , HOH A:429 , HOH A:439 , HOH A:472binding site for residue MG A 302
03AC3SOFTWAREVAL A:134 , TYR A:135 , ARG A:136 , PRO A:137 , ALA A:138 , ALA A:139 , TYR A:140 , ASP A:141 , PRO A:158 , GLN A:161 , HOH A:408 , TYR B:222binding site for residue G A 303
04AC4SOFTWAREASN A:40 , SER A:46binding site for residue GOL A 304
05AC5SOFTWAREILE A:270 , ASN A:283 , ARG A:286 , ARG A:290 , HOH A:403 , HOH A:441binding site for residue GOL A 305
06AC6SOFTWARELEU A:146 , GLN A:149 , ILE A:276 , HOH A:402 , PHE B:212 , ALA B:214 , HOH B:637binding site for residue GOL A 306
07AC7SOFTWARETYR A:192 , GLY A:193 , ARG A:232binding site for residue SO4 A 307
08AC8SOFTWARETYR A:192 , LYS A:225 , ASP A:228 , ARG A:232 , HOH A:450binding site for residue SO4 A 308
09AC9SOFTWARETYR A:140 , ASP A:141 , PRO A:158 , HOH A:408 , TYR G:140 , ASP G:141 , HOH G:433binding site for residue SO4 A 309
10AD1SOFTWAREGLN A:105 , ARG A:136 , HIS A:190 , GLU A:195 , GNP A:301 , HOH A:489 , ASN B:182 , GLY B:183 , VAL B:184 , GLY B:185 , LYS B:186 , THR B:187 , THR B:188 , LYS B:192 , ARG B:213 , GLN B:219 , GLY B:265 , LYS B:321 , ASP B:323 , GLY B:346 , VAL B:347 , GLY B:348 , GLN B:349 , MG B:402 , HOH B:527 , HOH B:532 , HOH B:545 , HOH B:547 , HOH B:553 , HOH B:555binding site for residue GNP B 401
11AD2SOFTWARETHR B:187 , GNP B:401 , HOH B:527 , HOH B:532 , HOH B:547binding site for residue MG B 402
12AD3SOFTWARETYR A:135 , ASN B:350 , TYR B:351 , HOH B:550binding site for residue GOL B 403
13AD4SOFTWAREHOH A:419 , THR B:211 , PHE B:212 , ARG B:213 , ALA B:215 , ALA B:216 , GLN B:217 , GLU B:218binding site for residue GOL B 404
14AD5SOFTWARELYS B:172 , ASN B:201 , SER B:203 , ASP B:257 , HOH B:522 , HOH B:620 , PRO C:92 , LEU C:95 , HOH C:477binding site for residue GOL B 405
15AD6SOFTWARELYS B:278 , ARG B:289 , VAL B:312 , SO4 B:408binding site for residue GOL B 406
16AD7SOFTWARELEU B:231 , ILE B:232 , ARG B:233 , GLY B:234binding site for residue SO4 B 407
17AD8SOFTWAREARG B:282 , GOL B:406 , HOH B:612binding site for residue SO4 B 408
18AD9SOFTWAREGLN C:105 , GLY C:106 , SER C:107 , GLY C:108 , LYS C:109 , THR C:110 , THR C:111 , LYS C:115 , ARG C:136 , GLN C:142 , GLY C:188 , LYS C:246 , ASP C:248 , GLY C:271 , THR C:272 , GLY C:273 , GLU C:274 , MG C:302 , HOH C:431 , HOH C:447 , HOH C:456 , HOH C:473 , HOH C:490 , ASN D:182 , ARG D:213 , GNP D:401 , HOH D:542binding site for residue GNP C 301
19AE1SOFTWARETHR C:110 , GNP C:301 , HOH C:447 , HOH C:452 , HOH C:456binding site for residue MG C 302
20AE2SOFTWAREVAL C:134 , TYR C:135 , ARG C:136 , PRO C:137 , ALA C:138 , ALA C:139 , TYR C:140 , ASP C:141 , PRO C:158 , GLN C:161 , HOH C:413 , HOH C:459 , HOH C:467 , HOH C:501 , TYR D:222binding site for residue G C 303
21AE3SOFTWAREILE C:270 , PHE C:282 , ASN C:283 , ARG C:286 , ARG C:290 , HOH C:401 , HOH C:412binding site for residue GOL C 304
22AE4SOFTWAREGLN C:149 , GLU C:274 , LYS C:275 , HOH C:411 , PHE D:212 , HOH D:528 , HOH D:607binding site for residue GOL C 305
23AE5SOFTWARETHR C:196 , ARG C:232 , HOH C:417binding site for residue SO4 C 306
24AE6SOFTWAREGLN C:105 , ARG C:136 , HIS C:190 , GLU C:195 , GNP C:301 , ASN D:182 , GLY D:183 , VAL D:184 , GLY D:185 , LYS D:186 , THR D:187 , THR D:188 , LYS D:192 , ARG D:213 , GLN D:219 , GLY D:265 , LYS D:321 , ASP D:323 , GLY D:346 , VAL D:347 , GLY D:348 , GLN D:349 , MG D:402 , HOH D:512 , HOH D:514 , HOH D:516 , HOH D:535 , HOH D:542 , HOH D:560 , HOH D:580binding site for residue GNP D 401
25AE7SOFTWARETHR D:187 , GNP D:401 , HOH D:512 , HOH D:516 , HOH D:580binding site for residue MG D 402
26AE8SOFTWAREGLN D:349 , ASN D:350 , TYR D:351 , HOH D:556binding site for residue GOL D 403
27AE9SOFTWAREGLN E:105 , GLY E:106 , SER E:107 , GLY E:108 , LYS E:109 , THR E:110 , THR E:111 , LYS E:115 , ARG E:136 , GLN E:142 , GLY E:188 , LYS E:246 , ASP E:248 , GLY E:271 , THR E:272 , GLY E:273 , GLU E:274 , MG E:302 , HOH E:420 , HOH E:421 , HOH E:432 , HOH E:435 , HOH E:444 , HOH E:470 , HOH E:471 , ASN F:182 , MET F:267 , GNP F:401binding site for residue GNP E 301
28AF1SOFTWARETHR E:110 , GNP E:301 , HOH E:421 , HOH E:432 , HOH E:435binding site for residue MG E 302
29AF2SOFTWAREVAL E:134 , TYR E:135 , ARG E:136 , PRO E:137 , ALA E:138 , ALA E:139 , TYR E:140 , PRO E:158 , GLN E:161 , HOH E:415 , HOH E:422 , HOH E:476 , HOH E:518 , TYR F:222 , LYS F:226binding site for residue G E 303
30AF3SOFTWAREPHE E:282 , ASN E:283 , ARG E:290binding site for residue GOL E 304
31AF4SOFTWARELEU E:146 , GLN E:149 , GLU E:274 , LYS E:275 , ILE E:276 , HOH E:401 , HOH E:486 , HOH E:500 , PHE F:212 , ALA F:214binding site for residue GOL E 305
32AF5SOFTWARETYR E:192 , GLY E:193 , ARG E:232 , HOH E:418 , ASP F:325binding site for residue SO4 E 306
33AF6SOFTWAREGLN E:105 , ARG E:136 , HIS E:190 , GLU E:195 , GNP E:301 , HOH E:470 , ASN F:182 , GLY F:183 , VAL F:184 , GLY F:185 , LYS F:186 , THR F:187 , THR F:188 , LYS F:192 , ARG F:213 , GLN F:219 , GLY F:265 , LYS F:321 , ASP F:323 , GLY F:346 , VAL F:347 , GLY F:348 , GLN F:349 , MG F:402 , HOH F:522 , HOH F:523 , HOH F:528 , HOH F:536 , HOH F:551 , HOH F:555binding site for residue GNP F 401
34AF7SOFTWARETHR F:187 , GNP F:401 , HOH F:523 , HOH F:528 , HOH F:536binding site for residue MG F 402
35AF8SOFTWARETYR E:135 , GLN F:349 , ASN F:350 , TYR F:351 , HOH F:525binding site for residue GOL F 403
36AF9SOFTWAREGLN G:105 , GLY G:106 , SER G:107 , GLY G:108 , LYS G:109 , THR G:110 , THR G:111 , LYS G:115 , ARG G:136 , GLN G:142 , GLY G:188 , LYS G:246 , ASP G:248 , GLY G:271 , THR G:272 , GLY G:273 , GLU G:274 , MG G:302 , HOH G:424 , HOH G:430 , HOH G:440 , HOH G:456 , HOH G:489 , HOH G:494 , ASN H:182 , ARG H:213 , GNP H:401 , HOH H:558binding site for residue GNP G 301
37AG1SOFTWARETHR G:110 , GNP G:301 , HOH G:430 , HOH G:440 , HOH G:456binding site for residue MG G 302
38AG2SOFTWAREVAL G:134 , TYR G:135 , PRO G:137 , ALA G:138 , ALA G:139 , TYR G:140 , ASP G:141 , PRO G:158 , GLN G:161 , HOH G:423 , HOH G:433 , HOH G:523 , TYR H:222 , LYS H:226binding site for residue G G 303
39AG3SOFTWAREASN A:177 , TYR G:125 , LYS G:126 , VAL G:127 , GLY G:151 , VAL G:152 , HOH G:410binding site for residue GOL G 304
40AG4SOFTWARELEU G:146 , GLN G:149 , GLU G:274 , LYS G:275 , ILE G:276 , PHE H:212 , TYR H:236 , HOH H:605binding site for residue GOL G 305
41AG5SOFTWAREMET G:247 , PHE G:282 , ASN G:283 , ARG G:286 , PHE G:287 , ARG G:290 , HOH G:403 , HOH G:438binding site for residue GOL G 306
42AG6SOFTWARETYR G:192 , GLY G:193 , THR G:196 , ARG G:232 , ASP H:325binding site for residue SO4 G 307
43AG7SOFTWAREGLN G:105 , ARG G:136 , HIS G:190 , GLU G:195 , GNP G:301 , ASN H:182 , GLY H:183 , VAL H:184 , GLY H:185 , LYS H:186 , THR H:187 , THR H:188 , LYS H:192 , ARG H:213 , GLN H:219 , GLY H:265 , LYS H:321 , ASP H:323 , GLY H:346 , VAL H:347 , GLY H:348 , GLN H:349 , MG H:402 , HOH H:524 , HOH H:533 , HOH H:546 , HOH H:547 , HOH H:549 , HOH H:558 , HOH H:571binding site for residue GNP H 401
44AG8SOFTWARETHR H:187 , GNP H:401 , HOH H:533 , HOH H:549 , HOH H:571binding site for residue MG H 402
45AG9SOFTWAREGLN H:349 , ASN H:350 , TYR H:351 , HOH H:506 , HOH H:541binding site for residue GOL H 403
46AH1SOFTWAREARG H:289 , SO4 H:405binding site for residue GOL H 404
47AH2SOFTWARELYS H:278 , ARG H:282 , GOL H:404 , HOH H:525 , HOH H:529binding site for residue SO4 H 405

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5L3S)

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Leu A:95 -Pro A:96
2Lys B:172 -Pro B:173
3Leu C:95 -Pro C:96
4Lys D:172 -Pro D:173
5Leu E:95 -Pro E:96
6Lys F:172 -Pro F:173
7Leu G:95 -Pro G:96
8Lys H:172 -Pro H:173

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5L3S)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5L3S)

(-) Exons   (0, 0)

(no "Exon" information available for 5L3S)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:274
                                                                                                                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh..............eeeeee.....hhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhh.eeee.....hhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhhhhhhh..eeeeeee.....hhhhhhhhhhhhh...eeeee.......hhhhhhhhhhhh.eeeeee.......eee.hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5l3s A  16 STPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKSVLERKEWFISIVYDELSKLFGGKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRIL 292
                                    25        35        45        55   ||   67        77      ||88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288    
                                                                      59|                    84|                                                                                                                                                                                                              
                                                                       62                     86                                                                                                                                                                                                              


Chain B from PDB  Type:PROTEIN  Length:283
                                                                                                                                                                                                                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..eee...hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh....eeeeee.....hhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhhhh.eee......hhhhhhhhhhhhhhhh...eeeeee......hhhhhhhhhhhhhhhh..eeeeeee....hhhhhhhhhhhhhh...eeeee........hhhhhhhhhhh..eeeee.......eee.hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5l3s B  86 KYKTIKEDDLNDVIEELRFQLLDSDVSYEVTEKILEDLKNNLIGKKVSRREEVEEIVINTLKKSITEILTKNQKTDLIEKIRSSGKKPFVIIFFGVNGVGKTTTIAKVVNMLKKNNLSTIIAASDTFRAAAQEQLAYHASKLEVQLIRGKYGADPASVAFDAISFAKSRNIDVVLIDTAGRMHIDSDLVEELKKVLRIAKPDFRILILDSLAGSDALEQARHFENNVGYDAVILTKVDADAKGGIALSLAYELKKPVVYMGVGQNYDDLIPFSPDWFVERIFS 368
                                    95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365   


Chain C from PDB  Type:PROTEIN  Length:270
                                                                                                                                                                                                                                                                                                              
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..............eeeeee.....hhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhhhh.eee......hhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhhhhhhhhh..eeeeeee.....hhhhhhhhhhhhh...eeeee.......hhhhhhhhhhhh.eeeeee.......eee.hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5l3s C  16 STPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRIL 292
                                    25        35        45        55   ||   72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292
                                                                      59|                                                                                                                                                                                                                                 
                                                                       67                                                                                                                                                                                                                                 


Chain D from PDB  Type:PROTEIN  Length:271
                                                                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh...hhhhhhhh.....eeeeee.....hhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhhhh.eee......hhhhhhhhhhhhhhhhh..eeeeee......hhhhhhhhhhhhhhhh..eeeeeee....hhhhhhhhhhhhhh...eeeee........hhhhhhhhhhh..eeeee.......eee.hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5l3s D  92 EDDLNDVIEELRFQLLDSDVSYEVTEKILEDLKNNLIGKEVEEIVINTLKKSITEILTKNQKTDLIEKIRSSGKKPFVIIFFGVNGVGKTTTIAKVVNMLKKNNLSTIIAASDTFRAAAQEQLAYHASKLEVQLIRGKYGADPASVAFDAISFAKSRNIDVVLIDTAGRMHIDSDLVEELKKVLRIAKPDFRILILDSLAGSDALEQARHFENNVGYDAVILTKVDADAKGGIALSLAYELKKPVVYMGVGQNYDDLIPFSPDWFVERIFS 368
                                   101       111       121       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367 
                                                                130|                                                                                                                                                                                                                                       
                                                                 137                                                                                                                                                                                                                                       


Chain E from PDB  Type:PROTEIN  Length:271
                                                                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.............eeeeee.....hhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhh.eeee.....hhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhhhhhhh..eeeeeee.....hhhhhhhhhhhhh...eeeee.......hhhhhhhhhhhh.eeeeee.......eee.hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5l3s E  16 STPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKRKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRIL 292
                                    25        35        45        55   ||   71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291 
                                                                      59|                                                                                                                                                                                                                                  
                                                                       66                                                                                                                                                                                                                                  


Chain F from PDB  Type:PROTEIN  Length:283
                                                                                                                                                                                                                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee.hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..ee...hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh....eeeeee.....hhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhhhh.eee......hhhhhhhhhhhhhhhhh..eeeeee......hhhhhhhhhhhhhhhh..eeeeeee....hhhhhhhhhhhhhh...eeeee........hhhhhhhhhhh..eeeee.......eee.hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5l3s F  85 LKYKTIKEDDLNDVIEELRFQLLDSDVSYEVTEKILEDLKNNLIGKKVSREEVEEIVINTLKKSITEILTKNQKTDLIEKIRSSGKKPFVIIFFGVNGVGKTTTIAKVVNMLKKNNLSTIIAASDTFRAAAQEQLAYHASKLEVQLIRGKYGADPASVAFDAISFAKSRNIDVVLIDTAGRMHIDSDLVEELKKVLRIAKPDFRILILDSLAGSDALEQARHFENNVGYDAVILTKVDADAKGGIALSLAYELKKPVVYMGVGQNYDDLIPFSPDWFVERIFS 368
                                    94       104       114       124       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365   
                                                                          133|                                                                                                                                                                                                                                         
                                                                           135                                                                                                                                                                                                                                         


Chain G from PDB  Type:PROTEIN  Length:277
                                                                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh..............eeeeee.....hhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhh.eee......hhhhhhhhhhhhhhhh...eeeee......hhhhhhhhhhhhhhhhhhh..eeeeeee.....hhhhhhhhhhhhh...eeeee.......hhhhhhhhhhhh.eeeeee.......eee.hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5l3s G  16 STPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRIL 292
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       


Chain H from PDB  Type:PROTEIN  Length:278
                                                                                                                                                                                                                                                                                                                      
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh....eeeeee.....hhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhhhh.eee......hhhhhhhhhhhhhhhh...eeeeee......hhhhhhhhhhhhhhhh..eeeeeee....hhhhhhhhhhhhhh...eeeeehhhhh...hhhhhhhhhhh..eeeee.......eee.hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5l3s H  90 IKEDDLNDVIEELRFQLLDSDVSYEVTEKILEDLKNNLIGKKVSRREVEEIVINTLKKSITEILTKNQKTDLIEKIRSSGKKPFVIIFFGVNGVGKTTTIAKVVNMLKKNNLSTIIAASDTFRAAAQEQLAYHASKLEVQLIRGKYGADPASVAFDAISFAKSRNIDVVLIDTAGRMHIDSDLVEELKKVLRIAKPDFRILILDSLAGSDALEQARHFENNVGYDAVILTKVDADAKGGIALSLAYELKKPVVYMGVGQNYDDLIPFSPDWFVERIFS 368
                                    99       109       119       129     ||140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360        
                                                                       135|                                                                                                                                                                                                                                       
                                                                        137
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5L3S)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5L3S)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5L3S)

(-) Gene Ontology  (13, 19)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    G  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GNP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
    AG6  [ RasMol ]  +environment [ RasMol ]
    AG7  [ RasMol ]  +environment [ RasMol ]
    AG8  [ RasMol ]  +environment [ RasMol ]
    AG9  [ RasMol ]  +environment [ RasMol ]
    AH1  [ RasMol ]  +environment [ RasMol ]
    AH2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:95 - Pro A:96   [ RasMol ]  
    Leu C:95 - Pro C:96   [ RasMol ]  
    Leu E:95 - Pro E:96   [ RasMol ]  
    Leu G:95 - Pro G:96   [ RasMol ]  
    Lys B:172 - Pro B:173   [ RasMol ]  
    Lys D:172 - Pro D:173   [ RasMol ]  
    Lys F:172 - Pro F:173   [ RasMol ]  
    Lys H:172 - Pro H:173   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5l3s
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FTSY_SULAC | P27414
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  SRP54_SULSO | Q97ZE7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FTSY_SULAC | P27414
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SRP54_SULSO | Q97ZE7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FTSY_SULAC | P27414: 5l3w
        SRP54_SULSO | Q97ZE7: 1qzw 1qzx 2iy3 3kl4 3zn8 5l3v

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5L3S)