Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE SRII/HTRII COMPLEX IN I212121 SPACE GROUP ("U" SHAPE) - M STATE
 
Authors :  A. Ishchenko, E. Round, V. Borshchevskiy, S. Grudinin, I. Gushchin, J. A. Remeeva, V. Polovinkin, P. Utrobin, T. Balandin, M. Engelhard, G. B V. Gordeliy
Date :  23 Apr 16  (Deposition) - 15 Feb 17  (Release) - 15 Feb 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Sensory Rhodopsin Ii, Transducer, Membrane Protein Complex, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Ishchenko, E. Round, V. Borshchevskiy, S. Grudinin, I. Gushchin, J. P. Klare, A. Remeeva, V. Polovinkin, P. Utrobin, T. Balandin, M. Engelhard, G. Buldt, V. Gordeliy
New Insights On Signal Propagation By Sensory Rhodopsin Ii/Transducer Complex.
Sci Rep V. 7 41811 2017
PubMed-ID: 28165484  |  Reference-DOI: 10.1038/SREP41811

(-) Compounds

Molecule 1 - SENSORY RHODOPSIN-2
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: SOP2, SOPII
    Organism Common: NATRONOBACTERIUM PHARAONIS
    Organism Scientific: NATRONOMONAS PHARAONIS
    Organism Taxid: 2257
    Synonym: SENSORY RHODOPSIN II,SR-II
 
Molecule 2 - SENSORY RHODOPSIN II TRANSDUCER
    Chains: B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: HTR2, HTRII
    Organism Common: NATRONOBACTERIUM PHARAONIS
    Organism Scientific: NATRONOMONAS PHARAONIS
    Organism Taxid: 2257
    Synonym: HTR-II,METHYL-ACCEPTING PHOTOTAXIS PROTEIN II,MPP-II

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (2x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 14)

Asymmetric Unit (3, 14)
No.NameCountTypeFull Name
1BOG1Ligand/IonB-OCTYLGLUCOSIDE
2LFA12Ligand/IonEICOSANE
3RET1Ligand/IonRETINAL
Biological Unit 1 (3, 28)
No.NameCountTypeFull Name
1BOG2Ligand/IonB-OCTYLGLUCOSIDE
2LFA24Ligand/IonEICOSANE
3RET2Ligand/IonRETINAL

(-) Sites  (13, 13)

Asymmetric Unit (13, 13)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:75 , TRP A:76 , THR A:79 , THR A:80 , ILE A:83 , VAL A:108 , MET A:109 , GLY A:112 , PHE A:127 , GLY A:130 , ALA A:131 , PHE A:134 , TRP A:171 , TYR A:174 , PRO A:175 , TRP A:178 , ASP A:201 , THR A:204 , LYS A:205 , HOH A:405binding site for residue RET A 301
02AC2SOFTWAREGLU A:33 , TYR A:36 , TYR A:37 , LEU A:40 , LEU A:90 , ILE A:156 , ALA A:216binding site for residue BOG A 302
03AC3SOFTWAREVAL A:142binding site for residue LFA A 303
04AC4SOFTWAREVAL A:38binding site for residue LFA A 304
05AC5SOFTWAREGLY A:14 , ALA A:195 , LEU A:202 , LEU B:32binding site for residue LFA A 305
06AC6SOFTWAREVAL A:132 , LEU A:135 , GLY A:136 , TYR A:139binding site for residue LFA A 306
07AC7SOFTWARETYR A:124binding site for residue LFA A 307
08AC8SOFTWAREGLY A:59 , ILE A:74 , LEU A:78binding site for residue LFA A 308
09AC9SOFTWARETRP A:9 , THR A:19 , TRP A:24 , GLY A:45 , ALA A:48 , VAL A:49 , VAL A:52binding site for residue LFA A 309
10AD1SOFTWAREALA A:172 , PRO A:175 , PHE A:176binding site for residue LFA A 310
11AD2SOFTWAREVAL A:142 , ARG A:164binding site for residue LFA A 311
12AD3SOFTWAREASP B:52 , ALA B:53binding site for residue LFA B 202
13AD4SOFTWAREVAL A:206 , ILE A:211 , VAL B:25 , PHE B:28binding site for residue LFA B 203

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5JJF)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5JJF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5JJF)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5JJF)

(-) Exons   (0, 0)

(no "Exon" information available for 5JJF)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:221
                                                                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh...eeee..eeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jjf A   2 VGLTTLFWLGAIGMLVGTLAFAWAGRDAGSGERRYYVTLVGISGIAAVAYVVMALGVGWVPVAERTVFAPRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVPGIERYALFGMGAVAFLGLVYYLVGPMTESASQRSSGIKSLYVRLRNLTVILWAIYPFIWLLGPPGVALLTPTVDVALIVYLDLVTKVGFGFIALDAAATLRAE 222
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221 


Chain B from PDB  Type:PROTEIN  Length:63
                                                                                               
               SCOP domains --------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------- Transcript
                 5jjf B  22 MGAVFIFVGALTVLFGAIAYGEVTAAAATGDAAAVQEAAVSAILGLIILLGINLGLVAATLGG  84
                                    31        41        51        61        71        81
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5JJF)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5JJF)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5JJF)

(-) Gene Ontology  (14, 20)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BOG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    LFA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    RET  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5jjf)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5jjf
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BACS2_NATPH | P42196
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  HTR2_NATPH | P42259
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  BACS2_NATPH | P42196
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  HTR2_NATPH | P42259
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BACS2_NATPH | P42196: 1gu8 1gue 1h2s 1h68 1jgj 2f93 2f95 3qap 3qdc 4gyc 5jje 5jjj 5jjn
        HTR2_NATPH | P42259: 1h2s 2f93 2f95 2rm8 4gyc 5jje 5jjj 5jjn

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5JJF)