Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ENTEROCOCCUS FAECALIS LIPOATE-PROTEIN LIGASE A (LPLA-2) IN COMPLEX WITH 8-BROMOOCTANOIC ACID
 
Authors :  S. J. Hughes, J. H. Song, T. Antoshchenko, H. W. Park
Date :  24 Feb 16  (Deposition) - 15 Mar 17  (Release) - 15 Mar 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.55
Chains :  Asym./Biol. Unit :  A
Keywords :  Protein-Ligand Complex, Ligase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. J. Hughes, J. H. Song, T. Antoshchenko, H. W. Park
Crystal Structure Of Enterococcus Faecalis Lipoate-Protein Ligase A (Lpla-2) In Complex With 8-Bromooctanoic Acid
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - LIPOATE--PROTEIN LIGASE
    ChainsA
    EC Number2.7.7.63
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28-MHL
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneLPLA-2, EF_2741
    Organism ScientificENTEROCOCCUS FAECALIS (STRAIN ATCC 700802 / V583)
    Organism Taxid226185
    StrainATCC 700802 / V583

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1SH61Ligand/Ion8-BROMOOCTANOIC ACID

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:35 , ARG A:68 , GLY A:72 , GLY A:73 , VAL A:75 , HIS A:77 , LYS A:131 , HIS A:147 , THR A:149 , PHE A:286 , HOH A:511binding site for residue SH6 A 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5IDH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5IDH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5IDH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5IDH)

(-) Exons   (0, 0)

(no "Exon" information available for 5IDH)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:316
                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee.....hhhhhhhhhhhhhhh......eeeee....eeee....hhhhhhhhhhhhhh..eeee.......eee...eeeeeeeee...hhhhhhhhhhhhhhh....eeee...eeee..eeeeeeeeeee..eeeeeeeee.....hhhhhhh.....hhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhh.....hhhhhhhhhhhhhhh..hhhhhh.......eeeeeee..eeeeeeeeee..eeeeeeeee.......hhhhhhhhh....hhhhhhhhhh..hhhhhhh..hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5idh A  -2 FQGMIFVPNENNDPRVNLAIETYLLTEMPLDEPILLFYINEPSIIIGRNQNTIEEINKEYVDEHGIHVVRRLSGGGAVYHDHGNLNFSFIMPDDDFAKVTQPIIQALHDLGVEGAELKGRNDLVINDMKFSGNAMYATNGRMFAHGTLMFDSDIDEVVNTLKRVTNIKPFLSEDKQEMTTEEFRQEILLKIFGVDSIDQVKTYELTDQDWAAINKISEQYYRNWDWNYGKSPAFNLERRHRFPIGSIEMKMNVADGAIQEIKIFGDFFGLGEIKDVEDILTGVKYDKASLEEAIDQIDVKKYFGNIEKEDLLGLIY 334
                                     7        17        27        37        47        57        67        77        87   ||  102       112       122       132       142       152       162 ||    188       198       208       218       228       238       248       258       268       278       288       298       308       318       328      
                                                                                                                        91|                                                                164|                                                                                                                                                         
                                                                                                                         97                                                                 181                                                                                                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5IDH)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5IDH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5IDH)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SH6  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5idh)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5idh
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q830N7_ENTFA | Q830N7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.7.7.63
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q830N7_ENTFA | Q830N7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q830N7_ENTFA | Q830N75iby 5ich 5icl

(-) Related Entries Specified in the PDB File

5iby 5ich 5icl 5iy1