Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ENTEROCOCCUS FAECALIS LIPOATE-PROTEIN LIGASE A (LPLA-2) IN COMPLEX WITH LIPOYL-AMP
 
Authors :  S. J. Hughes, T. Antoshchenko, J. H. Song, H. W. Park
Date :  23 Feb 16  (Deposition) - 15 Mar 17  (Release) - 15 Mar 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Ligase, Protein-Substrate Complex, Lipoic Acid, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. J. Hughes, T. Antoshchenko, J. H. Song, H. W. Park
Crystal Structure Of Enterococcus Faecalis Lipoate-Protein Ligase A (Lpla-2) In Complex With Lipoyl-Amp
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - LIPOATE--PROTEIN LIGASE
    Chains: A, B
    EC Number: 2.7.7.63
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28-MHL
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: LPLA-2, EF_2741
    Organism Scientific: ENTEROCOCCUS FAECALIS (STRAIN ATCC 700802 / V583)
    Organism Taxid: 226185
    Strain: ATCC 700802 / V583

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1LAQ2Ligand/Ion5'-O-[(R)-({5-[(3R)-1,2-DITHIOLAN-3-YL]PENTANOYL}OXY)(HYDROXY)PHOSPHORYL]ADENOSINE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1LAQ1Ligand/Ion5'-O-[(R)-({5-[(3R)-1,2-DITHIOLAN-3-YL]PENTANOYL}OXY)(HYDROXY)PHOSPHORYL]ADENOSINE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1LAQ1Ligand/Ion5'-O-[(R)-({5-[(3R)-1,2-DITHIOLAN-3-YL]PENTANOYL}OXY)(HYDROXY)PHOSPHORYL]ADENOSINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:35 , ARG A:68 , GLY A:73 , VAL A:75 , TYR A:76 , HIS A:77 , ASN A:81 , ASN A:123 , LYS A:131 , GLY A:134 , HIS A:147 , THR A:149 , MET A:151 , VAL A:159 , PHE A:286 , HOH A:539 , HOH A:574 , HOH A:581binding site for residue LAQ A 401
2AC2SOFTWARETYR B:35 , ARG B:68 , GLY B:73 , ALA B:74 , VAL B:75 , TYR B:76 , HIS B:77 , ASN B:81 , ASN B:123 , LYS B:131 , GLY B:134 , HIS B:147 , THR B:149 , MET B:151 , VAL B:159 , HOH B:502 , HOH B:508 , HOH B:518 , HOH B:535 , HOH B:570 , HOH B:582binding site for residue LAQ B 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5ICL)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5ICL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5ICL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5ICL)

(-) Exons   (0, 0)

(no "Exon" information available for 5ICL)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:320
                                                                                                                                                                                                                                                                                                                                                                
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee.....hhhhhhhhhhhhhhhh.....eeeee....eeee....hhhhhh.hhhhhhh..eeee.......eee.....eeeeeee.......hhhhhhhhhhhhhhhh....eeee...eeee..eeeeeeeeeee..eeeeee......hhhhhhhhh....hhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhh.....hhhhhhhhhhhhhhh..hhhhhh.......eeeeeee..eeeeeeeeee..eeeeeeeee.......hhhhhhhhh....hhhhhhhhhhh.hhhhhhh..hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5icl A  -2 FQGMIFVPNENNDPRVNLAIETYLLTEMPLDEPILLFYINEPSIIIGRNQNTIEEINKEYVDEHGIHVVRRLSGGGAVYHDHGNLNFSFIMPDDGNSFRDFAKVTQPIIQALHDLGVEGAELKGRNDLVINDMKFSGNAMYATNGRMFAHGTLMFDSDIDEVVNTLRVTNIKPFLSEDKQEMTTEEFRQEILLKIFGVDSIDQVKTYELTDQDWAAINKISEQYYRNWDWNYGKSPAFNLERRHRFPIGSIEMKMNVADGAIQEIKIFGDFFGLGEIKDVEDILTGVKYDKASLEEAIDQIDVKKYFGNIEKEDLLGLIY 334
                                     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157     ||184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334
                                                                                                                                                                                               163|                                                                                                                                                         
                                                                                                                                                                                                181                                                                                                                                                         


Chain B from PDB  Type:PROTEIN  Length:321
                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee.....hhhhhhhhhhhhhhhh.....eeeee....eeee....hhhhhhhhhhhhhh..eeee.......eee...eeeeeeeee.......hhhhhhhhhhhhhhhh.....eee...eeee..eeeeeeeeeee..eeeeeeeee...hhhhhhhhh.....hhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhh.....hhhhhhhhhhhhhhh..hhhhhh.......eeeeeee..eeeeeeeeee..eeeeeeeee......hhhhhhhhhh....hhhhhhhhhhh.hhhhhh...hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5icl B  -2 FQGMIFVPNENNDPRVNLAIETYLLTEMPLDEPILLFYINEPSIIIGRNQNTIEEINKEYVDEHGIHVVRRLSGGGAVYHDHGNLNFSFIMPDDGNSFRDFAKVTQPIIQALHDLGVEGAELKGRNDLVINDMKFSGNAMYATNGRMFAHGTLMFDSDIDEVVNTLKRVTNIKPFLSEDKQEMTTEEFRQEILLKIFGVDSIDQVKTYELTDQDWAAINKISEQYYRNWDWNYGKSPAFNLERRHRFPIGSIEMKMNVADGAIQEIKIFGDFFGLGEIKDVEDILTGVKYDKASLEEAIDQIDVKKYFGNIEKEDLLGLIY 334
                                     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157      |183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333 
                                                                                                                                                                                                164|                                                                                                                                                         
                                                                                                                                                                                                 181
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5ICL)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5ICL)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5ICL)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    LAQ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5icl)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5icl
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q830N7_ENTFA | Q830N7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.7.7.63
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q830N7_ENTFA | Q830N7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q830N7_ENTFA | Q830N7: 5iby 5ich 5idh

(-) Related Entries Specified in the PDB File

5iby 5ich 5idh 5iy1