Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MONKEY TLR7 IN COMPLEX WITH R848
 
Authors :  Z. Zhang, U. Ohto, T. Shimizu
Date :  14 Jul 16  (Deposition) - 02 Nov 16  (Release) - 02 Nov 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Immune System, Tlr7, Innate Immunity, Ssrna Recogniton (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Z. Zhang, U. Ohto, T. Shibata, E. Krayukhina, M. Taoka, Y. Yamauchi, H. Tanji, T. Isobe, S. Uchiyama, K. Miyake, T. Shimizu
Structural Analysis Reveals That Toll-Like Receptor 7 Is A Dual Receptor For Guanosine And Single-Stranded Rna
Immunity V. 45 737 2016
PubMed-ID: 27742543  |  Reference-DOI: 10.1016/J.IMMUNI.2016.09.011

(-) Compounds

Molecule 1 - TOLL-LIKE RECEPTOR 7
    Chains: A, B
    Engineered: YES
    Expression System: DROSOPHILA
    Expression System Taxid: 7215
    Expression System Vector Type: BACULOVIRUS
    Fragment: UNP RESIDUES 27-839
    Gene: TLR7
    Mutation: YES
    Organism Common: RHESUS MACAQUE
    Organism Scientific: MACACA MULATTA
    Organism Taxid: 9544
    Synonym: UNCHARACTERIZED PROTEIN

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 48)

Asymmetric/Biological Unit (3, 48)
No.NameCountTypeFull Name
1NAG18Ligand/IonN-ACETYL-D-GLUCOSAMINE
2RX82Ligand/Ion1-[4-AMINO-2-(ETHOXYMETHYL)-1H-IMIDAZO[4,5-C]QUINOLIN-1-YL]-2-METHYLPROPAN-2-OL
3SO428Ligand/IonSULFATE ION

(-) Sites  (45, 45)

Asymmetric Unit (45, 45)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:555 , LEU A:557 , GLY A:584 , ILE A:585 , THR A:586 , HOH A:1111 , PHE B:351 , VAL B:355 , TYR B:356 , PHE B:408binding site for residue RX8 A 901
02AC2SOFTWAREARG A:308 , TYR A:741 , GLN A:744binding site for residue SO4 A 911
03AC3SOFTWARETHR A:532 , HIS A:558binding site for residue SO4 A 912
04AC4SOFTWARELYS A:386 , SER A:387 , ASN A:413 , HOH A:1094binding site for residue SO4 A 913
05AC5SOFTWAREHIS A:558 , SER A:559 , THR A:560binding site for residue SO4 A 914
06AC6SOFTWARETHR A:65 , THR B:832binding site for residue SO4 A 915
07AC7SOFTWAREARG A:784 , VAL A:815 , HOH A:1296 , ARG B:784 , SO4 B:911binding site for residue SO4 A 916
08AC8SOFTWARELYS A:418 , GLN A:419 , PHE A:420 , LYS A:421 , ARG A:422binding site for residue SO4 A 917
09AC9SOFTWAREGLY A:61 , GLY A:62 , ARG A:87binding site for residue SO4 A 918
10AD1SOFTWARETYR A:184 , ASN A:214 , ASN A:215 , ASN A:234 , ASN A:235 , MET A:236 , TYR A:468 , HOH A:1031 , HOH A:1178binding site for residue SO4 A 919
11AD2SOFTWAREARG A:376 , ASP A:427 , VAL A:459 , TYR A:492 , HOH A:1001binding site for residue SO4 A 920
12AD3SOFTWARETYR A:751binding site for residue SO4 A 921
13AD4SOFTWARELYS A:493 , ARG A:545binding site for residue SO4 A 922
14AD5SOFTWAREARG A:736 , LYS A:758 , ARG A:784 , ARG B:784binding site for residue SO4 A 923
15AD6SOFTWARESER A:107 , LYS A:108 , SER A:109 , SER B:663 , LYS B:688 , HOH B:1028binding site for residue SO4 A 924
16AD7SOFTWAREGLN A:496 , LYS A:520 , GLU A:543binding site for residue SO4 A 925
17AD8SOFTWAREARG A:750binding site for residue SO4 A 926
18AD9SOFTWARELYS A:207 , VAL A:208 , THR A:228 , GLU A:229binding site for residue SO4 A 927
19AE1SOFTWAREPHE A:351 , VAL A:355 , TYR A:356 , PHE A:408 , THR B:532 , ASP B:555 , GLY B:584 , ILE B:585 , THR B:586binding site for residue RX8 B 901
20AE2SOFTWARESO4 A:916 , ARG B:736 , LYS B:758 , HOH B:1145binding site for residue SO4 B 911
21AE3SOFTWAREARG B:308 , LYS B:311binding site for residue SO4 B 912
22AE4SOFTWAREHIS B:558 , SER B:559binding site for residue SO4 B 913
23AE5SOFTWARESER A:663 , PHE A:664 , LYS A:688 , SER B:107 , LYS B:108 , SER B:109 , HOH B:1013 , HOH B:1214binding site for residue SO4 B 914
24AE6SOFTWAREGLN B:496 , LYS B:520 , GLU B:543binding site for residue SO4 B 915
25AE7SOFTWARELYS B:418 , GLN B:419 , PHE B:420 , LYS B:421 , ARG B:422binding site for residue SO4 B 916
26AE8SOFTWARELYS B:493 , ARG B:545binding site for residue SO4 B 917
27AE9SOFTWAREPRO B:82 , PHE B:85 , ARG B:121 , SER B:122 , GLY B:125 , LEU B:126 , HOH B:1105binding site for residue SO4 B 918
28AF1SOFTWARETHR A:832 , THR B:65binding site for residue SO4 B 919
29AF2SOFTWAREARG B:357 , ALA B:358 , SER B:359binding site for residue SO4 B 920
30AF3SOFTWARETHR B:532 , HIS B:558binding site for residue SO4 B 921
31AF4SOFTWAREASN A:69 , GLU A:93 , SER A:131binding site for Mono-Saccharide NAG A 905 bound to ASN A 69
32AF5SOFTWARECYS A:183 , TYR A:184 , PRO A:188 , CYS A:189 , TYR A:190 , VAL A:191 , SER A:192 , ASN A:215binding site for Poly-Saccharide residues NAG A 903 through NAG A 904 bound to ASN A 215
33AF6SOFTWARELYS A:328 , GLY A:331 , ASN A:361 , ASN B:770binding site for Mono-Saccharide NAG A 910 bound to ASN A 361
34AF7SOFTWAREASN A:413 , SER A:415 , LYS A:418 , GLN A:514 , HIS A:515 , ARG B:723binding site for Mono-Saccharide NAG A 908 bound to ASN A 413
35AF8SOFTWARESER A:490 , CYS A:491 , SER A:501 , LYS A:502 , ASN A:523 , TYR A:546 , ASP A:548 , HOH A:1041binding site for Mono-Saccharide NAG A 902 bound to ASN A 523
36AF9SOFTWAREASN A:534 , SER A:536 , HOH A:1241binding site for Mono-Saccharide NAG A 909 bound to ASN A 534
37AG1SOFTWARESER A:559 , MET A:588 , ASN A:590 , SER A:613 , HOH A:1273binding site for Mono-Saccharide NAG A 906 bound to ASN A 590
38AG2SOFTWAREGLU A:242 , ASP A:243 , ASN A:246 , ASN A:284 , ARG A:717 , ASN A:720 , ARG A:723 , HOH A:1020 , HOH A:1032 , HOH A:1203binding site for Mono-Saccharide NAG A 907 bound to ASN A 720
39AG3SOFTWAREASN B:69 , VAL B:92 , GLU B:93 , SER B:131 , GLN B:151binding site for Poly-Saccharide residues NAG B 905 through NAG B 906 bound to ASN B 69
40AG4SOFTWARECYS B:183 , TYR B:184 , CYS B:189 , TYR B:190 , VAL B:191 , SER B:192 , ASN B:215binding site for Poly-Saccharide residues NAG B 903 through NAG B 904 bound to ASN B 215
41AG5SOFTWAREGLY B:331 , ASP B:332 , ASN B:361binding site for Mono-Saccharide NAG B 910 bound to ASN B 361
42AG6SOFTWAREASN B:413 , SER B:415 , LYS B:418 , GLN B:514 , HIS B:515binding site for Mono-Saccharide NAG B 909 bound to ASN B 413
43AG7SOFTWARESER B:490 , CYS B:491 , SER B:501 , ASN B:523 , TYR B:546 , ASP B:548binding site for Mono-Saccharide NAG B 902 bound to ASN B 523
44AG8SOFTWAREASN B:534 , SER B:536binding site for Mono-Saccharide NAG B 908 bound to ASN B 534
45AG9SOFTWARESER B:559 , MET B:588 , ASN B:590 , SER B:613binding site for Mono-Saccharide NAG B 907 bound to ASN B 590

(-) SS Bonds  (18, 18)

Asymmetric/Biological Unit
No.Residues
1A:36 -A:51
2A:98 -A:475
3A:100 -A:112
4A:183 -A:189
5A:260 -A:273
6A:263 -A:270
7A:491 -A:521
8A:787 -A:814
9A:789 -A:833
10B:36 -B:51
11B:98 -B:475
12B:100 -B:112
13B:183 -B:189
14B:260 -B:273
15B:263 -B:270
16B:491 -B:521
17B:787 -B:814
18B:789 -B:833

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Thr A:221 -Val A:222
2Gly A:816 -Pro A:817
3Thr B:221 -Val B:222
4Gly B:816 -Pro B:817

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5GMH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5GMH)

(-) Exons   (0, 0)

(no "Exon" information available for 5GMH)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:772
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eeeee....eeeee..................eee.......ee............eee.....................ee............eee..................eee.......eehhhhhhhhh...eee...............ee............eee..................eee.....................eee.................hhhhh................eee.........hhhhhh......eee.....hhhhhhhhhhhhhh....eee................hhhhhhh....eee.......eehhhhhhhhh......eee.......ee.hhhhhhhh...eee..........................hhhhh.eee.........hhhhhh......eee......................eee.....................eee....hhhhhh.....hhhhhhhh....eee..............ee....eee....hhhhhh............ee....eee......................eee.........hhhhhhhh....eee...........hhhhh.....eee.....................eee.........hhhhhhhhhhh...eee........hhhhhhhhhhhhhh...............hhhhh..hhhhh.hhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5gmh A  27 ARWFPKTLPCDVTLDVSKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLVHLVEIDFRCNCVPIRLGSKSNMCPRRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKEQLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTTVPTVLPSTLTELYLYNNMIAEIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCTPCKNNSPLQIPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINNLQELDLSQNFLAKEIGDAKFLHFLPNLIQLDLSFNFELQVYRASMNLSQAFSSLKSLKILRIRGYVFKELKSFQLSPLHNLQNLEVLDLGTNFIKIANLSMFKQFKRLKVIDLSVNKISPVLEQLYYFRYDKYARSCSCYKYGQTLDLSKNSIFFIKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPLAELRYLDFSNNRLDLLHSTAFEELRKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWRDGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFIWEKLRYLKNLETLDLSHNQLTTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLLHHNRFLCTCDAVWFVWWVQHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCEL 835
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       459       469     ||493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673       683       693       703       713       723       733       743       753       763       773       783       793       803       813       823       833  
                                                                                                                                                                                                                                                                                                                                                                                                                                                  435|             475|                                                                                                                                                                                                                                                                                                                                                         
                                                                                                                                                                                                                                                                                                                                                                                                                                                   459              490                                                                                                                                                                                                                                                                                                                                                         


Chain B from PDB  Type:PROTEIN  Length:772
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eeeee....eeeee..................eee.......ee............eee.....................ee............eee..................eee.......eehhhhhhhhh...eee...............ee............eee..................eee.....................eee.................hhhhh................eee.........hhhhhh......eee.....hhhhhhhhhhhhhh....eee..........eee...hhhhhhh....eee.....eeeehhhhhhhhh......eee.......ee.hhhhhhhh...eee..........................hhhhh.eee.........hhhhhh......eee......................eee.....................eee....hhhhhh.....hhhhhh......eee..............ee....eee....hhhhhh............ee....eee......................eee.........hhhhhhhh....eee...........hhhhh.....eee.....................eee..............hhhhhh...eee........hhhhhhhhhhhhhh...............hhhhh..hhhhh.hhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5gmh B  27 ARWFPKTLPCDVTLDVSKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLVHLVEIDFRCNCVPIRLGSKSNMCPRRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKEQLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTTVPTVLPSTLTELYLYNNMIAEIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCTPCKNNSPLQIPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINNLQELDLSQNFLAKEIGDAKFLHFLPNLIQLDLSFNFELQVYRASMNLSQAFSSLKSLKILRIRGYVFKELKSFQLSPLHNLQNLEVLDLGTNFIKIANLSMFKQFKRLKVIDLSVNKISPVLEQLYYFRYDKYARSCSCYKYGQTLDLSKNSIFFIKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPLAELRYLDFSNNRLDLLHSTAFEELRKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWRDGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFIWEKLRYLKNLETLDLSHNQLTTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLLHHNRFLCTCDAVWFVWWVQHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCEL 835
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       459       469     ||493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673       683       693       703       713       723       733       743       753       763       773       783       793       803       813       823       833  
                                                                                                                                                                                                                                                                                                                                                                                                                                                  435|             475|                                                                                                                                                                                                                                                                                                                                                         
                                                                                                                                                                                                                                                                                                                                                                                                                                                   459              490
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5GMH)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5GMH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5GMH)

(-) Gene Ontology  (32, 32)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    RX8  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
    AG6  [ RasMol ]  +environment [ RasMol ]
    AG7  [ RasMol ]  +environment [ RasMol ]
    AG8  [ RasMol ]  +environment [ RasMol ]
    AG9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:816 - Pro A:817   [ RasMol ]  
    Gly B:816 - Pro B:817   [ RasMol ]  
    Thr A:221 - Val A:222   [ RasMol ]  
    Thr B:221 - Val B:222   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5gmh
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B3Y653_MACMU | B3Y653
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B3Y653_MACMU | B3Y653
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        B3Y653_MACMU | B3Y653: 5gmf 5gmg

(-) Related Entries Specified in the PDB File

5gmf 5gmg