Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE ATP BINDING DOMAIN OF S. AUREUS GYRB COMPLEXED WITH A LIGAND
 
Authors :  J. Zhang, Q. Yang, J. B. Cross, J. A. C. Romero, M. D. Ryan, B. Lippa, R. E. D O. A. Andersen, J. Barker, R. K. Cheng, J. Kahmann, B. Felicetti, M. Woo C. Scheich
Date :  13 Aug 15  (Deposition) - 25 Nov 15  (Release) - 25 Nov 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.55
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Dna Gyrase, Gyrb, Ligand, Structure-Based Design, Isomerase-Isomerase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Zhang, Q. Yang, J. B. Cross, J. A. Romero, K. M. Poutsiaka, F. Epie, D. Bevan, B. Wang, Y. Zhang, A. Chavan, X. Zhang, T. Moy, A. Daniel, K. Nguyen, B. Chamberlain, N. Carter, J. Shotwell, J. Silverman, C. A. Metcalf, D. Ryan, B. Lippa, R. E. Dolle
Discovery Of Azaindole Ureas As A Novel Class Of Bacterial Gyrase B Inhibitors.
J. Med. Chem. V. 58 8503 2015
PubMed-ID: 26460684  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.5B00961

(-) Compounds

Molecule 1 - DNA GYRASE SUBUNIT B
    ChainsA, B
    EC Number5.99.1.3
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET24
    Expression System StrainROSETTA 2 (DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentATP BINDING DOMAIN, UNP RESIDUES 2-234 (DELTA 105-127)
    GeneGYRB
    Organism ScientificSTAPHYLOCOCCUS AUREUS
    Organism Taxid1280

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 14)

Asymmetric Unit (3, 14)
No.NameCountTypeFull Name
157W2Ligand/Ion1-ETHYL-3-[1-(PYRIDIN-2-YL)-6-(PYRIDIN-3-YL)-1H-PYRROLO[3,2-B]PYRIDIN-3-YL]UREA
2MG8Ligand/IonMAGNESIUM ION
3MPD4Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
Biological Unit 1 (2, 3)
No.NameCountTypeFull Name
157W1Ligand/Ion1-ETHYL-3-[1-(PYRIDIN-2-YL)-6-(PYRIDIN-3-YL)-1H-PYRROLO[3,2-B]PYRIDIN-3-YL]UREA
2MG-1Ligand/IonMAGNESIUM ION
3MPD2Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
Biological Unit 2 (2, 3)
No.NameCountTypeFull Name
157W1Ligand/Ion1-ETHYL-3-[1-(PYRIDIN-2-YL)-6-(PYRIDIN-3-YL)-1H-PYRROLO[3,2-B]PYRIDIN-3-YL]UREA
2MG-1Ligand/IonMAGNESIUM ION
3MPD2Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:81 , LYS A:170 , THR A:171 , MPD A:302 , HOH A:409 , HOH A:483binding site for residue MPD A 301
02AC2SOFTWARETYR A:141 , HIS A:143 , MPD A:301binding site for residue MPD A 302
03AC3SOFTWAREASN A:54 , SER A:55 , GLU A:58 , VAL A:79 , ASP A:81 , ARG A:84 , GLY A:85 , ILE A:86 , PRO A:87 , ILE A:102 , ARG A:144 , THR A:173 , HOH A:422 , HOH A:450binding site for residue 57W A 303
04AC4SOFTWAREGLU A:50 , HOH A:416 , HOH A:477 , HOH A:487 , HOH A:532binding site for residue MG A 304
05AC5SOFTWARETHR B:80 , ASP B:81 , HIS B:143 , LYS B:170 , THR B:171 , GLY B:172 , MPD B:302binding site for residue MPD B 301
06AC6SOFTWARETYR B:141 , HIS B:143 , GLU B:186 , MPD B:301binding site for residue MPD B 302
07AC7SOFTWARETHR A:185 , ASN B:54 , SER B:55 , GLU B:58 , VAL B:79 , ASP B:81 , ARG B:84 , GLY B:85 , ILE B:86 , PRO B:87 , ILE B:102 , ARG B:144 , THR B:173 , HOH B:458 , HOH B:493binding site for residue 57W B 303
08AC8SOFTWAREASP B:53 , ASP B:57 , HOH B:406 , HOH B:426 , HOH B:447 , HOH B:501binding site for residue MG B 304
09AC9SOFTWAREGLU B:164 , GLU B:219 , HOH B:512 , HOH B:531 , HOH B:538binding site for residue MG B 305
10AD1SOFTWAREHOH A:419 , HOH A:521 , LEU B:60 , HOH B:503 , HOH B:505 , HOH B:565binding site for residue MG B 306
11AD2SOFTWAREASN B:54 , MG B:310 , HOH B:421 , HOH B:429 , HOH B:506 , HOH B:542 , HOH B:562binding site for residue MG B 307
12AD3SOFTWAREASN B:82 , GLY B:83 , THR B:171 , HOH B:479 , HOH B:504 , HOH B:514binding site for residue MG B 308
13AD4SOFTWAREGLY B:208 , HIS B:228 , HOH B:478 , HOH B:519binding site for residue MG B 309
14AD5SOFTWAREASP B:53 , MG B:307 , HOH B:406 , HOH B:421 , HOH B:429 , HOH B:432 , HOH B:562binding site for residue MG B 310

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5D7C)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5D7C)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5D7C)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5D7C)

(-) Exons   (0, 0)

(no "Exon" information available for 5D7C)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:192
                                                                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh....eeeeeeehhheeeeee...............hhhhhhhhhhhhhhheeeeeeeeee..eeeeeeee..ee....eeeee....eeeeeeee...........hhhhhhhhhhhhhhhh...eeeeee.......eeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5d7c A  16 AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE 230
                                    25        35        45        55        65        75        85        95       128       138       148       158       168       178       188       198       208       218       228  
                                                                                                                  104|                                                                                                      
                                                                                                                   128                                                                                                      

Chain B from PDB  Type:PROTEIN  Length:186
                                                                                                                                                                                                                          
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh....eeeeee....eeeeee............hhhhhhhhhhhhhhheeeeeeeeee..eeeeeeee..ee....eeeee....eeeeeeee...........hhhhhhhhhhhhhhhh...eeeeee.......eeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5d7c B  20 QVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEG 231
                                    29        39        49        59        69        79        89 ||    102 ||    135       145       155       165       175       185       195       205       215       225      
                                                                                                  91|      104|                                                                                                       
                                                                                                   95       128                                                                                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5D7C)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5D7C)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5D7C)

(-) Gene Ontology  (13, 13)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    57W  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MPD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5d7c)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5d7c
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GYRB_STAAU | P0A0K8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.99.1.3
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GYRB_STAAU | P0A0K8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GYRB_STAAU | P0A0K83g75 3g7b 3ttz 3u2d 3u2k 4plb 4urm 4uro 5bs3 5cph 5ctu 5ctw 5ctx 5cty 5d6p 5d6q 5d7d 5d7r 5iwi 5iwm

(-) Related Entries Specified in the PDB File

5cph 5ctu 5ctw 5ctx 5cty 5d6p 5d6q 5d7d 5d7r