Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE ATP BINDING DOMAIN OF S. AUREUS GYRB COMPLEXED WITH A FRAGMENT
 
Authors :  O. A. Andersen, J. Barker, R. K. Cheng, J. Kahmann, B. Felicetti, M. Wood C. Scheich, M. Mesleh, J. B. Cross, J. Zhang, Q. Yang, B. Lippa, M. D. Rya
Date :  24 Jul 15  (Deposition) - 03 Feb 16  (Release) - 17 Feb 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.45
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Dna Gyrase, Gyrb, Fragment-Based Screening, Structure-Based Design, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. F. Mesleh, J. B. Cross, J. Zhang, J. Kahmann, O. A. Andersen, J. Barker, R. K. Cheng, B. Felicetti, M. Wood, A. T. Hadfield, C. Scheich, T. I. Moy, Q. Yang, J. Shotwell, K. Nguyen, B. Lippa, R. Dolle, M. D. Ryan
Fragment-Based Discovery Of Dna Gyrase Inhibitors Targeting The Atpase Subunit Of Gyrb.
Bioorg. Med. Chem. Lett. V. 26 1314 2016
PubMed-ID: 26786695  |  Reference-DOI: 10.1016/J.BMCL.2016.01.009

(-) Compounds

Molecule 1 - DNA GYRASE SUBUNIT B
    ChainsA, B
    EC Number5.99.1.3
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET24
    Expression System StrainROSETTA 2 (DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentATP BINDING DOMAIN, UNP RESIDUES 2-234 (DELTA 105-127)
    GeneGYRB
    Organism ScientificSTAPHYLOCOCCUS AUREUS
    Organism Taxid1280

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 7)

Asymmetric Unit (4, 7)
No.NameCountTypeFull Name
154X2Ligand/Ion5-(THIOPHEN-2-YL)THIENO[2,3-D]PYRIMIDIN-4(1H)-ONE
2CL1Ligand/IonCHLORIDE ION
3MG1Ligand/IonMAGNESIUM ION
4MPD3Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
154X1Ligand/Ion5-(THIOPHEN-2-YL)THIENO[2,3-D]PYRIMIDIN-4(1H)-ONE
2CL-1Ligand/IonCHLORIDE ION
3MG-1Ligand/IonMAGNESIUM ION
4MPD1Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
Biological Unit 2 (2, 3)
No.NameCountTypeFull Name
154X1Ligand/Ion5-(THIOPHEN-2-YL)THIENO[2,3-D]PYRIMIDIN-4(1H)-ONE
2CL-1Ligand/IonCHLORIDE ION
3MG-1Ligand/IonMAGNESIUM ION
4MPD2Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL

(-) Sites  (15, 15)

Asymmetric Unit (15, 15)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETHR A:80 , ASP A:81 , HIS A:143 , THR A:171 , HOH A:523binding site for residue MPD A 301
02AC2SOFTWAREVAL A:88 , ARG A:144 , ASN A:145 , HOH A:518 , HOH A:598binding site for residue CL A 302
03AC3SOFTWAREASN A:54 , GLU A:58 , ASP A:81 , ARG A:84 , GLY A:85 , ILE A:86 , HOH A:421 , HOH A:508 , HOH A:513binding site for residue 54X A 303
04AC4SOFTWARETHR B:80 , ASP B:81 , HIS B:143 , LYS B:170 , GLY B:172 , MPD B:302 , HOH B:421binding site for residue MPD B 301
05AC5SOFTWAREHIS B:143 , VAL B:174 , GLU B:186 , MPD B:301 , HOH B:530binding site for residue MPD B 302
06AC6SOFTWAREGLY B:0 , ASN B:54 , HOH B:415 , HOH B:446 , HOH B:447 , HOH B:559 , HOH B:622binding site for residue MG B 304
07AC7SOFTWARESER B:1 , THR B:3 , ALA B:4 , LEU B:5 , ASN B:54 , GLU B:58 , ASP B:81 , ARG B:84 , GLY B:85 , ILE B:86 , PRO B:87 , HOH B:401 , HOH B:405 , HOH B:408 , HOH B:449 , HOH B:466 , HOH B:549 , HOH B:566binding site for Di-peptide 54X B 303 and VAL B 2
08AC8SOFTWARESER B:1 , THR B:3 , ALA B:4 , LEU B:5 , ASN B:54 , GLU B:58 , ASP B:81 , ARG B:84 , GLY B:85 , ILE B:86 , PRO B:87 , HOH B:401 , HOH B:405 , HOH B:408 , HOH B:449 , HOH B:466 , HOH B:549 , HOH B:566binding site for Di-peptide 54X B 303 and VAL B 2
09AC9SOFTWARESER B:1 , THR B:3 , ALA B:4 , LEU B:5 , ASN B:54 , GLU B:58 , ASP B:81 , ARG B:84 , GLY B:85 , ILE B:86 , PRO B:87 , HOH B:401 , HOH B:405 , HOH B:408 , HOH B:449 , HOH B:466 , HOH B:549 , HOH B:566binding site for Di-peptide 54X B 303 and VAL B 2
10AD1SOFTWARESER B:1 , THR B:3 , ALA B:4 , LEU B:5 , ASN B:54 , GLU B:58 , ASP B:81 , ARG B:84 , GLY B:85 , ILE B:86 , PRO B:87 , HOH B:401 , HOH B:405 , HOH B:408 , HOH B:449 , HOH B:466 , HOH B:549 , HOH B:566binding site for Di-peptide 54X B 303 and VAL B 2
11AD2SOFTWARESER B:1 , THR B:3 , ALA B:4 , LEU B:5 , ASN B:54 , GLU B:58 , ASP B:81 , ARG B:84 , GLY B:85 , ILE B:86 , PRO B:87 , HOH B:401 , HOH B:405 , HOH B:408 , HOH B:449 , HOH B:466 , HOH B:549 , HOH B:566binding site for Di-peptide 54X B 303 and VAL B 2
12AD3SOFTWARESER B:1 , THR B:3 , ALA B:4 , LEU B:5 , ASN B:54 , GLU B:58 , ASP B:81 , ARG B:84 , GLY B:85 , ILE B:86 , PRO B:87 , HOH B:401 , HOH B:405 , HOH B:408 , HOH B:449 , HOH B:466 , HOH B:549 , HOH B:566binding site for Di-peptide 54X B 303 and VAL B 2
13AD4SOFTWARESER B:1 , THR B:3 , ALA B:4 , LEU B:5 , ASN B:54 , GLU B:58 , ASP B:81 , ARG B:84 , GLY B:85 , ILE B:86 , PRO B:87 , HOH B:401 , HOH B:405 , HOH B:408 , HOH B:449 , HOH B:466 , HOH B:549 , HOH B:566binding site for Di-peptide 54X B 303 and VAL B 2
14AD5SOFTWARESER B:1 , THR B:3 , ALA B:4 , LEU B:5 , ASN B:54 , GLU B:58 , ASP B:81 , ARG B:84 , GLY B:85 , ILE B:86 , PRO B:87 , HOH B:401 , HOH B:405 , HOH B:408 , HOH B:449 , HOH B:466 , HOH B:549 , HOH B:566binding site for Di-peptide 54X B 303 and VAL B 2
15AD6SOFTWAREGLY B:0 , SER B:1 , VAL B:2 , THR B:3 , ALA B:4 , ASN B:54 , GLU B:58 , ASP B:81 , ARG B:84 , GLY B:85 , ILE B:86 , ILE B:102 , HOH B:402 , HOH B:403 , HOH B:405 , HOH B:449 , HOH B:466 , HOH B:566 , HOH B:594binding site for Di-peptide 54X B 303 and LEU B 5

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5CTU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5CTU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5CTU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5CTU)

(-) Exons   (0, 0)

(no "Exon" information available for 5CTU)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:192
                                                                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh....eeeeeeehhheeeeee...............hhhhhhhhhhhhhhheeeeeeeeee..eeeeeeee..ee....eeeee....eeeeeeee...........hhhhhhhhhhhhhhhh...eeeeee.......eeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5ctu A  16 AGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYE 230
                                    25        35        45        55        65        75        85        95       128       138       148       158       168       178       188       198       208       218       228  
                                                                                                                  104|                                                                                                      
                                                                                                                   128                                                                                                      

Chain B from PDB  Type:PROTEIN  Length:192
                                                                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh....eeeeeee...eeeeee............hhhhhhhh.hhhhhheeeeeeeeee..eeeeeeee..ee....eeeee....eeeeeeee...........hhhhhhhhhhhhhhhh...eeeeee.......eeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5ctu B   0 GSVTALQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQGRPAVEVILTSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEG 231
                                 || 23        33        43        53        63        73        83       |96       129       139       149       159       169       179       189       199       209       219       229  
                                 5|                                                                     91|      104|                                                                                                       
                                 20                                                                      95       128                                                                                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5CTU)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5CTU)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5CTU)

(-) Gene Ontology  (13, 13)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    54X  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MPD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5ctu)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ctu
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GYRB_STAAU | P0A0K8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.99.1.3
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GYRB_STAAU | P0A0K8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GYRB_STAAU | P0A0K83g75 3g7b 3ttz 3u2d 3u2k 4plb 4urm 4uro 5bs3 5cph 5ctw 5ctx 5cty 5d6p 5d6q 5d7c 5d7d 5d7r 5iwi 5iwm

(-) Related Entries Specified in the PDB File

5cph 5ctw 5ctx 5cty