5B6T - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CATALYTIC DOMAIN OF COPRINOPSIS CINEREA GH62 ALPHA-L-ARABINOFURANOSIDASE COMPLEXED WITH PB

Authors :   T. Tonozuka

Date :   01 Jun 16 (Deposition) - 07 Sep 16 (Release) - 15 Feb 17 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.48

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Coprinopsis Cinerea, Alpha-L-Arabinofuranosidase, Arabinoxylan, Gh62, Hemicellulose, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Tonozuka, Y. Tanaka, S. Okuyama, T. Miyazaki, A. Nishikawa, M. Yoshida
Structure Of The Catalytic Domain Of Alpha-L-Arabinofuranosidase From Coprinopsis Cinerea, Ccabf62A, Provides Insights Into Structure-Function Relationships In Glycoside Hydrolase Family 62
Appl. Biochem. Biotechnol. V. 181 511 2017
PubMed-ID: 27589854 | Reference-DOI: 10.1007/S12010-016-2227-0

Molecule 1 - GLYCOSYL HYDROLASE FAMILY 62 PROTEIN
	Chains	:	A, B
	EC Number	:	3.2.1.55
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET21A
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 82-397
	Gene	:	CC1G_01577
	Organism Common	:	INKY CAP FUNGUS
	Organism Scientific	:	COPRINOPSIS CINEREA (STRAIN OKAYAMA-7 / 130 / ATCC MYA-4618 / FGSC 9003)
	Organism Taxid	:	240176
	Strain	:	OKAYAMA-7 / 130 / ATCC MYA-4618 / FGSC 9003
	Synonym	:	ALPHA-L-ARABINOFURANOSIDASE

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 9)

No.	Name	Count	Type	Full Name
1	CA	2	Ligand/Ion	CALCIUM ION
2	GOL	6	Ligand/Ion	GLYCEROL
3	PB	1	Ligand/Ion	LEAD (II) ION

Biological Unit 1 (1, 4)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	GOL	4	Ligand/Ion	GLYCEROL
3	PB	-1	Ligand/Ion	LEAD (II) ION

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	GOL	2	Ligand/Ion	GLYCEROL
3	PB	-1	Ligand/Ion	LEAD (II) ION

Asymmetric Unit (9, 9)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLU A:276 , TYR A:380 , GOL A:502 , HOH A:717 , HOH A:768	binding site for residue PB A 500
2	AC2	SOFTWARE	HIS A:346 , HOH A:619 , HOH A:673 , HOH A:799 , HOH A:847 , HOH A:876	binding site for residue CA A 501
3	AC3	SOFTWARE	LYS A:108 , ASP A:109 , TYR A:131 , GLN A:181 , VAL A:223 , ASP A:224 , TYR A:380 , PB A:500 , HOH A:631 , HOH A:665	binding site for residue GOL A 502
4	AC4	SOFTWARE	PHE A:149 , TYR A:150 , TYR A:151 , HOH A:644 , HOH A:700 , ILE B:212 , ASN B:215	binding site for residue GOL A 503
5	AC5	SOFTWARE	TYR A:135 , SER A:137 , SER A:148 , HOH A:610 , HOH A:830	binding site for residue GOL A 504
6	AC6	SOFTWARE	ARG A:214 , ASN A:215 , HOH A:618 , HOH A:649	binding site for residue GOL A 505
7	AC7	SOFTWARE	HIS B:346 , HOH B:634 , HOH B:639 , HOH B:769 , HOH B:833 , HOH B:836	binding site for residue CA B 501
8	AC8	SOFTWARE	LYS B:108 , ASP B:109 , TYR B:131 , GLN B:181 , VAL B:223 , ASP B:224 , TYR B:380 , HOH B:622 , HOH B:670	binding site for residue GOL B 502
9	AC9	SOFTWARE	ARG A:87 , ALA A:330 , ASN A:331 , VAL A:333 , ALA A:334 , HOH A:638 , ASP B:153 , GLN B:154 , ALA B:155 , GLY B:158 , THR B:159 , HOH B:714	binding site for residue GOL B 503

Asymmetric Unit

No.	Residues
1	A:229	-	A:234
2	A:363	-	A:397
3	B:229	-	B:234
4	B:363	-	B:397

Asymmetric Unit

No.	Residues
1	Phe A:255	-	Pro A:256
2	Gly A:314	-	Pro A:315
3	Phe B:255	-	Pro B:256
4	Gly B:314	-	Pro B:315

(no "SAP(SNP)/Variant" information available for 5B6T)

(no "PROSITE Motif" information available for 5B6T)

(no "Exon" information available for 5B6T)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:317
                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee...............eeeeeeeeee..eeeeeeeeee..eeeeeeeee.hhhhh....eee.hhh.......eeeeeeeehhhheeeeeee...eeeeee....hhhhh...ee.....hhhhhhhh.....eeeeeee...eeeeeee....eeeeeeee...........eeeee..hhhhh.eeeeeeee....eeeeeeeee.....eeeeeeee.......ee..........hhh.eee.........eeeee.........ee.....eeeeee.......hhhhh..eeeeeee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5b6t A  82 LPSSFRWSSSGPLIGPKSDSRRIQGIKDPSVVYHDGRWHVFASTAKTEGYNLVYISFTDWAQAGSASFYYLDQAPLGTGYRAAPQVFYFAPQRLWYLVYQNGNAAYSTNPDINNPAGWTAPRTFYSGMPAIIRNNIGNGHWVDMWVICDSSLCHLFSSDDNGHLYRSQTSLSNFPNGFNEPVIAMQDSNKNRLFEAANVYRIDGSNEYLLLHEAIGSDGRRWFRSWTSTSIAGPWRALADQESNPFARANNVAFTGNAWTRDISHGELIRSGNDQTLPISPCNLRYLYQGLDPNSGGDYNSLPWKLGLLTQTNSACA 398
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391

Chain B from PDB  Type:PROTEIN  Length:317
                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee...............eeeeeeeeee..eeeeeeeeee..eeeeeeeee.hhhhh....eee.hhh.......eeeeeeeehhhheeeeeee...eeeeee....hhhhh...ee.....hhhhhhhh.....eeeeeee...eeeeeee....eeeeeeee...........eeeee..hhhhh.eeeeeeee.....eeeeeeee.....eeeeeeee.......ee..ee..ee..hhh.eee.........eeeee.........ee.....eeeeee.......hhhhh..eeeeeee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5b6t B  82 LPSSFRWSSSGPLIGPKSDSRRIQGIKDPSVVYHDGRWHVFASTAKTEGYNLVYISFTDWAQAGSASFYYLDQAPLGTGYRAAPQVFYFAPQRLWYLVYQNGNAAYSTNPDINNPAGWTAPRTFYSGMPAIIRNNIGNGHWVDMWVICDSSLCHLFSSDDNGHLYRSQTSLSNFPNGFNEPVIAMQDSNKNRLFEAANVYRIDGSNEYLLLHEAIGSDGRRWFRSWTSTSIAGPWRALADQESNPFARANNVAFTGNAWTRDISHGELIRSGNDQTLPISPCNLRYLYQGLDPNSGGDYNSLPWKLGLLTQTNSACA 398
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 5B6T)

(no "CATH Domain" information available for 5B6T)

(no "Pfam Domain" information available for 5B6T)

Asymmetric Unit(hide GO term definitions)

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PB	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:314 - Pro A:315	[ RasMol ]
		Gly B:314 - Pro B:315	[ RasMol ]
		Phe A:255 - Pro A:256	[ RasMol ]
		Phe B:255 - Pro B:256	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	5b6t
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	A8NI40_COPC7 \| A8NI40
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	3.2.1.55
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	A8NI40_COPC7 \| A8NI40
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/TrEMBL
	A8NI40_COPC7 \| A8NI40	:	5b6s

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 9)

Sites (9, 9)

SS Bonds (4, 4)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (7, 7)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File