Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CATALYTIC DOMAIN OF COPRINOPSIS CINEREA GH62 ALPHA-L-ARABINOFURANOSIDASE
 
Authors :  T. Tonozuka
Date :  01 Jun 16  (Deposition) - 07 Sep 16  (Release) - 15 Feb 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Coprinopsis Cinerea, Alpha-L-Arabinofuranosidase, Arabinoxylan, Gh62, Hemicellulose, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Tonozuka, Y. Tanaka, S. Okuyama, T. Miyazaki, A. Nishikawa, M. Yoshida
Structure Of The Catalytic Domain Of Alpha-L-Arabinofuranosidase From Coprinopsis Cinerea, Ccabf62A, Provides Insights Into Structure-Function Relationships In Glycoside Hydrolase Family 62
Appl. Biochem. Biotechnol. V. 181 511 2017
PubMed-ID: 27589854  |  Reference-DOI: 10.1007/S12010-016-2227-0

(-) Compounds

Molecule 1 - GLYCOSYL HYDROLASE FAMILY 62 PROTEIN
    Chains: A, B
    EC Number: 3.2.1.55
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET21A
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 82-397
    Gene: CC1G_01577
    Organism Common: INKY CAP FUNGUS
    Organism Scientific: COPRINOPSIS CINEREA (STRAIN OKAYAMA-7 / 130 / ATCC MYA-4618 / FGSC 9003)
    Organism Taxid: 240176
    Strain: OKAYAMA-7 / 130 / ATCC MYA-4618 / FGSC 9003
    Synonym: ALPHA-L-ARABINOFURANOSIDASE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 9)

Asymmetric Unit (2, 9)
No.NameCountTypeFull Name
1CA2Ligand/IonCALCIUM ION
2GOL7Ligand/IonGLYCEROL
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2GOL4Ligand/IonGLYCEROL
Biological Unit 2 (1, 3)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2GOL3Ligand/IonGLYCEROL

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:346 , HOH A:625 , HOH A:626 , HOH A:772 , HOH A:854 , HOH A:858binding site for residue CA A 501
2AC2SOFTWARELYS A:108 , ASP A:109 , TYR A:131 , GLN A:181 , VAL A:223 , ASP A:224 , TYR A:380 , HOH A:628 , HOH A:657binding site for residue GOL A 502
3AC3SOFTWAREPHE A:149 , TYR A:150 , TYR A:151 , HOH A:671 , HOH A:706 , ASN B:215binding site for residue GOL A 503
4AC4SOFTWARETYR A:135 , SER A:137 , SER A:148 , HOH A:615 , HOH A:757binding site for residue GOL A 504
5AC5SOFTWAREARG A:214 , ASN A:215 , HOH A:604 , HOH A:644binding site for residue GOL A 505
6AC6SOFTWAREHIS B:346 , HOH B:627 , HOH B:693 , HOH B:780 , HOH B:825 , HOH B:828binding site for residue CA B 501
7AC7SOFTWARELYS B:108 , ASP B:109 , TYR B:131 , GLN B:181 , VAL B:223 , ASP B:224 , TYR B:380 , HOH B:660binding site for residue GOL B 502
8AC8SOFTWAREILE B:136 , SER B:137 , SER B:148 , HOH B:788 , HOH B:796binding site for residue GOL B 503
9AC9SOFTWAREARG A:87 , ALA A:330 , ASN A:331 , VAL A:333 , ALA A:334 , HOH A:646 , ASP B:153 , GLN B:154 , ALA B:155 , GLY B:158 , THR B:159 , HOH B:674binding site for residue GOL B 504

(-) SS Bonds  (4, 4)

Asymmetric Unit
No.Residues
1A:229 -A:234
2A:363 -A:397
3B:229 -B:234
4B:363 -B:397

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Phe A:255 -Pro A:256
2Gly A:314 -Pro A:315
3Phe B:255 -Pro B:256
4Gly B:314 -Pro B:315

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5B6S)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5B6S)

(-) Exons   (0, 0)

(no "Exon" information available for 5B6S)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:317
                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee...............eeeeeeeeee..eeeeeeeeee..eeeeeeeee.hhhhhhhh.eee.hhh.......eeeeeeeehhhheeeeeee...eeeeee....hhhhh...ee.....hhhhhhhh.....eeeeeee...eeeeeee....eeeeeeee...........eeeee..hhhhh.eeeeeeee....eeeeeeeee.....eeeeeeee.......ee..........hhh.eee.........eeeee.........ee.....eeeeee.......hhhhh..eeeeeee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5b6s A  82 LPSSFRWSSSGPLIGPKSDSRRIQGIKDPSVVYHDGRWHVFASTAKTEGYNLVYISFTDWAQAGSASFYYLDQAPLGTGYRAAPQVFYFAPQRLWYLVYQNGNAAYSTNPDINNPAGWTAPRTFYSGMPAIIRNNIGNGHWVDMWVICDSSLCHLFSSDDNGHLYRSQTSLSNFPNGFNEPVIAMQDSNKNRLFEAANVYRIDGSNEYLLLHEAIGSDGRRWFRSWTSTSIAGPWRALADQESNPFARANNVAFTGNAWTRDISHGELIRSGNDQTLPISPCNLRYLYQGLDPNSGGDYNSLPWKLGLLTQTNSACA 398
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       


Chain B from PDB  Type:PROTEIN  Length:317
                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee...............eeeeeeeeee..eeeeeeeeee..eeeeeeeee.hhhhh....eee.hhh.......eeeeeeeehhhheeeeeee...eeeeee....hhhhh...ee.....hhhhhhhh.....eeeeeee...eeeeeee....eeeeeeee...........eeeee..hhhhh.eeeeeeee.....eeeeeeee.....eeeeeeee.......ee..........hhh.eee.........eeeee.........ee.....eeeeee.......hhhhh..eeeeeee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5b6s B  82 LPSSFRWSSSGPLIGPKSDSRRIQGIKDPSVVYHDGRWHVFASTAKTEGYNLVYISFTDWAQAGSASFYYLDQAPLGTGYRAAPQVFYFAPQRLWYLVYQNGNAAYSTNPDINNPAGWTAPRTFYSGMPAIIRNNIGNGHWVDMWVICDSSLCHLFSSDDNGHLYRSQTSLSNFPNGFNEPVIAMQDSNKNRLFEAANVYRIDGSNEYLLLHEAIGSDGRRWFRSWTSTSIAGPWRALADQESNPFARANNVAFTGNAWTRDISHGELIRSGNDQTLPISPCNLRYLYQGLDPNSGGDYNSLPWKLGLLTQTNSACA 398
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5B6S)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5B6S)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5B6S)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:314 - Pro A:315   [ RasMol ]  
    Gly B:314 - Pro B:315   [ RasMol ]  
    Phe A:255 - Pro A:256   [ RasMol ]  
    Phe B:255 - Pro B:256   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5b6s
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A8NI40_COPC7 | A8NI40
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.55
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A8NI40_COPC7 | A8NI40
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        A8NI40_COPC7 | A8NI40: 5b6t

(-) Related Entries Specified in the PDB File

5b6t