Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  POLYKETIDE CYCLASE OAC FROM CANNABIS SATIVA, Y27W MUTANT
 
Authors :  X. Yang, T. Matsui, T. Mori, I. Abe, H. Morita
Date :  28 Oct 15  (Deposition) - 27 Jan 16  (Release) - 06 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Cannabis Sativa, Plant Polyketide Cyclase, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  X. Yang, T. Matsui, T. Kodama, T. Mori, X. Zhou, F. Taura, H. Noguchi, I. Abe, H. Morita
Structural Basis For Olivetolic Acid Formation By A Polyketide Cyclase From Cannabis Sativa
Febs J. V. 283 1088 2016
PubMed-ID: 26783002  |  Reference-DOI: 10.1111/FEBS.13654

(-) Compounds

Molecule 1 - OLIVETOLIC ACID CYCLASE
    ChainsA, B
    EC Number4.4.1.26
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPQE-80L
    Expression System StrainM15
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneOAC
    MutationYES
    Organism CommonHEMP
    Organism ScientificCANNABIS SATIVA
    Organism Taxid3483

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5B0D)

(-) Sites  (0, 0)

(no "Site" information available for 5B0D)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5B0D)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5B0D)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5B0D)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5B0D)

(-) Exons   (0, 0)

(no "Exon" information available for 5B0D)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:100
                                                                                                                                    
               SCOP domains ---------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeee....hhhhhhhhhhhhhhhhhh.....eeeeee............eeeeeee.hhhhhhhhhhhhhhhhhhhhh...eeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------- Transcript
                 5b0d A   2 AVKHLIVLKFKDEITEAQKEEFFKTWVNLVNIIPAMKDVYWGKDVTQKNKEEGYTHIVEVTFESVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTPRK 101
                                    11        21        31        41        51        61        71        81        91       101

Chain B from PDB  Type:PROTEIN  Length:98
                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeee....hhhhhhhhhhhhhh.........eeeeee..........eeeeeee.hhhhhhhhhhhhhhhhhhhhhh..eeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                 5b0d B   2 AVKHLIVLKFKDEITEAQKEEFFKTWVNLVNIIPAMKDVYWGKDVTQKNKGYTHIVEVTFESVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTPRK 101
                                    11        21        31        41        51|       63        73        83        93        
                                                                            51|                                               
                                                                             54                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5B0D)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5B0D)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5B0D)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5b0d)
 
  Sites
(no "Sites" information available for 5b0d)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5b0d)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5b0d
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  OLIAC_CANSA | I6WU39
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.4.1.26
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  OLIAC_CANSA | I6WU39
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        OLIAC_CANSA | I6WU395b08 5b09 5b0a 5b0b 5b0c 5b0e 5b0f 5b0g

(-) Related Entries Specified in the PDB File

5b08 5b09 5b0a 5b0b 5b0c 5b0e 5b0f 5b0g