|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 5)| Asymmetric Unit (2, 5) Biological Unit 1 (1, 2) Biological Unit 2 (1, 2) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 5PQ2) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 5PQ2) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 5PQ2) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 5PQ2) |
Exons (0, 0)| (no "Exon" information available for 5PQ2) |
Sequences/Alignments
Asymmetric Unit
Chain A from PDB Type:PROTEIN Length:121
SCOP domains ------------------------------------------------------------------------------------------------------------------------- SCOP domains
CATH domains ------------------------------------------------------------------------------------------------------------------------- CATH domains
Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains
SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
PROSITE ------------------------------------------------------------------------------------------------------------------------- PROSITE
Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript
5pq2 A 22 SMEQVAMELRLTELTRLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIG 142
31 41 51 61 71 81 91 101 111 121 131 141
Chain B from PDB Type:PROTEIN Length:123
SCOP domains --------------------------------------------------------------------------------------------------------------------------- SCOP domains
CATH domains --------------------------------------------------------------------------------------------------------------------------- CATH domains
Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
5pq2 B 22 SMEQVAMELRLTELTRLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLE 144
31 41 51 61 71 81 91 101 111 121 131 141
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 5PQ2) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 5PQ2) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 5PQ2) |
Gene Ontology (11, 11)|
Asymmetric Unit(hide GO term definitions) |
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|