5POE - JenaLib

Title :   PANDDA ANALYSIS GROUP DEPOSITION -- CRYSTAL STRUCTURE OF BRD1 IN COMPLEX WITH N10188A AND N07807B

Authors :   N. M. Pearce, T. Krojer, R. Talon, A. R. Bradley, M. Fairhead, R. Sethi, N E. Maclean, P. Collins, J. Brandao-Neto, A. Douangamath, Z. Renjie, A J. Ng, P. E. Brennan, O. Cox, C. Bountra, C. H. Arrowsmith, A. Edwards, F Delft

Date :   07 Feb 17 (Deposition) - 15 Mar 17 (Release) - 15 Mar 17 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.52

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Pandda, Sgc - Diamond I04-1 Fragment Screening, Bromodomain, Epigenetics, Xchemexplorer, Gene Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   N. M. Pearce, T. Krojer, A. R. Bradley, P. Collins, R. Nowak, R. Talon, B. Marsden, S. Kelm, J. Shi, D. Deane, F. Von Delft
A Multi-Crystal Method For Extracting Obscured Crystallographic States From Conventionally Uninterpretable Electron Density
Nat Commun 2017
PubMed: search

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 8)

Asymmetric Unit (4, 8)

No.	Name	Count	Type	Full Name
1	8T1	2	Ligand/Ion	6-AMINO-1-METHYLQUINOLIN-2(1H)-ONE
2	8T4	1	Ligand/Ion	1-METHYL-4-PHENYL-5-(1H-PYRROL-1-YL)-1H-PYRAZOLE
3	EDO	4	Ligand/Ion	1,2-ETHANEDIOL
4	NA	1	Ligand/Ion	SODIUM ION

Biological Unit 1 (2, 3)

No.	Name	Count	Type	Full Name
1	8T1	1	Ligand/Ion	6-AMINO-1-METHYLQUINOLIN-2(1H)-ONE
2	8T4	-1	Ligand/Ion	1-METHYL-4-PHENYL-5-(1H-PYRROL-1-YL)-1H-PYRAZOLE
3	EDO	2	Ligand/Ion	1,2-ETHANEDIOL
4	NA	-1	Ligand/Ion	SODIUM ION

Biological Unit 2 (3, 4)

No.	Name	Count	Type	Full Name
1	8T1	1	Ligand/Ion	6-AMINO-1-METHYLQUINOLIN-2(1H)-ONE
2	8T4	1	Ligand/Ion	1-METHYL-4-PHENYL-5-(1H-PYRROL-1-YL)-1H-PYRAZOLE
3	EDO	2	Ligand/Ion	1,2-ETHANEDIOL
4	NA	-1	Ligand/Ion	SODIUM ION

Sites (8, 8)

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TYR A:109 , ASN A:110 , EDO A:202 , 8T1 A:203 , MET B:23	binding site for residue EDO A 201
2	AC2	SOFTWARE	ILE A:54 , PHE A:55 , VAL A:59 , EDO A:201 , 8T1 A:203 , HOH A:301 , HOH A:348	binding site for residue EDO A 202
3	AC3	SOFTWARE	ILE A:54 , ASN A:110 , EDO A:201 , EDO A:202 , HOH A:301 , HOH A:403 , MET B:23 , VAL B:26 , HOH B:398	binding site for residue 8T1 A 203
4	AC4	SOFTWARE	LYS A:108 , HOH A:349 , HOH A:363 , MET B:107 , ASN B:110 , TYR B:117	binding site for residue NA B 201
5	AC5	SOFTWARE	CYS B:106 , ASN B:110 , 8T1 B:205 , HOH B:304 , HOH B:313	binding site for residue EDO B 202
6	AC6	SOFTWARE	LEU B:92 , GLU B:96 , LEU B:131 , ARG B:135 , HOH B:391	binding site for residue EDO B 203
7	AC7	SOFTWARE	ARG B:31 , LEU B:32 , PRO B:51 , LYS B:90 , HOH B:314 , HOH B:321 , HOH B:346 , HOH B:392 , HOH B:412 , HOH B:426 , HOH B:442 , HOH B:455 , HOH B:457	binding site for residue 8T4 B 204
8	AC8	SOFTWARE	GLN B:25 , ILE B:54 , ASN B:110 , PHE B:116 , EDO B:202 , HOH B:304 , HOH B:313 , HOH B:347 , HOH B:375 , HOH B:403	binding site for residue 8T1 B 205

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:123
                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhh....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 5poe A  22 SMEQVAMELRLTELTRLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLE 144
                                    31        41        51        61        71        81        91       101       111       121       131       141

Chain B from PDB  Type:PROTEIN  Length:123
                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh................hhhhhh....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 5poe B  22 SMEQVAMELRLTELTRLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLE 144
                                    31        41        51        61        71        81        91       101       111       121       131       141

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (11, 11)

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		8T1	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		8T4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5poe)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	5poe
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BRD1_HUMAN \| O95696
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description