Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  HIGH-SPEED FIXED-TARGET SERIAL VIRUS CRYSTALLOGRAPHY
 
Authors :  P. Roedig, H. M. Ginn, T. Pakendorf, G. Sutton, K. Harlos, T. S. Walter, J P. Fischer, R. Duman, I. Vartiainen, B. Reime, M. Warmer, A. S. Brewste I. D. Young, T. Michels-Clark, N. K. Sauter, M. Sikorsky, S. Nelson, D. S. Damiani, R. Alonso-Mori, J. Ren, E. E. Fry, C. David, D. I. Stuart, A. Meents
Date :  21 Dec 16  (Deposition) - 21 Jun 17  (Release) - 28 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (3x)
Keywords :  Viral Protein, Cypovirus Polyhedrin, Cpv18 (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. Roedig, H. M. Ginn, T. Pakendorf, G. Sutton, K. Harlos, T. S. Walter, J. Meyer, P. Fischer, R. Duman, I. Vartiainen, B. Reime, M. Warmer, A. S. Brewster, I. D. Young, T. Michels-Clark, N. K. Sauter, A. Kotecha J. Kelly, D. J. Rowlands, M. Sikorsky, S. Nelson, D. S. Damiani, R. Alonso-Mori, J. Ren, E. E. Fry, C. David, D. I. Stuart, A. Wagner, A. Meents
High-Speed Fixed-Target Serial Virus Crystallography.
Nat. Methods 2017
PubMed-ID: 28628129  |  Reference-DOI: 10.1038/NMETH.4335

(-) Compounds

Molecule 1 - POLYHEDRIN
    Chains: A
    Engineered: YES
    Expression System: UNIDENTIFIED BACULOVIRUS
    Expression System Taxid: 10469
    Organism Scientific: OPEROPHTERA BRUMATA CYPOVIRUS 18
    Organism Taxid: 352244

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (3x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 5)

Asymmetric Unit (5, 5)
No.NameCountTypeFull Name
1ACE1Mod. Amino AcidACETYL GROUP
2ATP1Ligand/IonADENOSINE-5'-TRIPHOSPHATE
3CL1Ligand/IonCHLORIDE ION
4GTP1Ligand/IonGUANOSINE-5'-TRIPHOSPHATE
5MG1Ligand/IonMAGNESIUM ION
Biological Unit 1 (3, 9)
No.NameCountTypeFull Name
1ACE3Mod. Amino AcidACETYL GROUP
2ATP3Ligand/IonADENOSINE-5'-TRIPHOSPHATE
3CL-1Ligand/IonCHLORIDE ION
4GTP3Ligand/IonGUANOSINE-5'-TRIPHOSPHATE
5MG-1Ligand/IonMAGNESIUM ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:31 , HOH A:552binding site for residue CL A 301
2AC2SOFTWAREARG A:18 , HIS A:170 , TYR A:172 , ASN A:173 , LYS A:184 , ATP A:303 , MG A:304 , HOH A:403 , HOH A:412 , HOH A:448 , HOH A:449 , HOH A:472 , HOH A:520 , HOH A:563binding site for residue GTP A 302
3AC3SOFTWARELYS A:152 , HIS A:154 , ASP A:156 , GLY A:157 , ILE A:159 , LYS A:184 , GTP A:302 , HOH A:403 , HOH A:437 , HOH A:452 , HOH A:485 , HOH A:494 , HOH A:540 , HOH A:555binding site for residue ATP A 303
4AC4SOFTWAREGTP A:302 , HOH A:448 , HOH A:595binding site for residue MG A 304

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5MQW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5MQW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5MQW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5MQW)

(-) Exons   (0, 0)

(no "Exon" information available for 5MQW)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:248
                                                                                                                                                                                                                                                                                        
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhhh....eeeeeeeee.....eeeeeeeee.eeeeee..............hhhhhhhhhhhhhh................eeeeee....hhhhheeeee........hhhhh.....hhhhheeeee..eeeeeeeeee........eeeeeee.............hhhhhhhhhhhheeeeeee.hhhhhhhhh.......ee.....ee........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mqw A   1 xADVAGTSNRDFRGREQRLYNSEQYNYNNSLNGEVSLWVYAYYSDGSVLVRNCNSQYKVGISECFKSLKEVRVGQNNDPYDEQEVNNGVYYPNGGEPTKFHSNAKPRAIQIIFSPSVNVHTIKMAKGNSVSIPKDYLQRSHPWEATGVKYRKIHVDGEIVGYSHYFELPHEYNSISLSVSGVHKNPSSYNVAAPHNIMDVFQSCDLALKFSNRYWCELELINHYISAYAYPYLDINNHKYGVPLNGRQ 248
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240        
                            |                                                                                                                                                                                                                                                       
                            1-ACE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5MQW)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5MQW)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5MQW)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ATP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GTP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5mqw)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5mqw
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q30C70_9REOV | Q30C70
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q30C70_9REOV | Q30C70
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q30C70_9REOV | Q30C70: 4ots 4otv 4x35 5a9p

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5MQW)