Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE STUDY OF THE X-RAY INDUCED ENZYMATIC REDUCTION OF MOLECULAR OXYGEN TO WATER FOR LACCASE FROM STECCHERINUM MURASHKINSKYI.THE THIRD STRUCTURE OF THE SERIES WITH TOTAL EXPOSITION TIME 63 MIN.
 
Authors :  K. M. Polyakov, S. Gavryushov, T. V. Fedorova, O. A. Glazunova, A. N. Pop
Date :  25 Nov 16  (Deposition) - 10 May 17  (Release) - 24 May 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.35
Chains :  Asym./Biol. Unit :  A
Keywords :  Multi Copper Oxidase, Laccase, Complex With Molecular Oxygen, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. M. Polyakov, S. Gavryushov, S. Ivanova, T. V. Fedorova, O. A. Glazunova, A. N. Popov, O. V. Koroleva
Structural Study Of The X-Ray-Induced Enzymatic Reduction O Molecular Oxygen To Water By Steccherinum Murashkinskyi Laccase: Insights Into The Reaction Mechanism.
Acta Crystallogr D Struct V. 73 388 2017 Biol
PubMed-ID: 28471364  |  Reference-DOI: 10.1107/S2059798317003667

(-) Compounds

Molecule 1 - LACCASE 2
    Chains: A
    EC Number: 1.10.3.2
    Organism Scientific: STECCHERINUM MURASHKINSKYI
    Organism Taxid: 627145

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (6, 14)

Asymmetric/Biological Unit (6, 14)
No.NameCountTypeFull Name
1BMA2Ligand/IonBETA-D-MANNOSE
2CIT1Ligand/IonCITRIC ACID
3CU4Ligand/IonCOPPER (II) ION
4NA1Ligand/IonSODIUM ION
5NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE
6OXY2Ligand/IonOXYGEN MOLECULE

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:112 , HIS A:402 , HIS A:452 , CU A:502 , OXY A:511 , HOH A:601 , HOH A:605binding site for residue CU A 501
02AC2SOFTWAREHIS A:65 , HIS A:67 , TRP A:108 , HIS A:110 , HIS A:454 , CU A:501 , CU A:503 , OXY A:511 , HOH A:601 , HOH A:605binding site for residue CU A 502
03AC3SOFTWAREHIS A:65 , HIS A:67 , HIS A:400 , HIS A:402 , CU A:502 , OXY A:511 , HOH A:605 , HOH A:904 , HOH A:996binding site for residue CU A 503
04AC4SOFTWAREHIS A:397 , CYS A:453 , ILE A:455 , HIS A:458binding site for residue CU A 504
05AC5SOFTWAREHIS A:65 , HIS A:110 , HIS A:112 , HIS A:400 , HIS A:402 , HIS A:452 , HIS A:454 , CU A:501 , CU A:502 , CU A:503 , OXY A:512 , HOH A:602 , HOH A:605binding site for residue OXY A 511
06AC6SOFTWAREHIS A:110 , HIS A:112 , TYR A:117 , ASP A:456 , OXY A:511 , HOH A:602 , HOH A:603 , HOH A:853binding site for residue OXY A 512
07AC7SOFTWARETHR A:293 , THR A:294 , THR A:295 , GLY A:431 , GLY A:432 , HOH A:623 , HOH A:719 , HOH A:827 , HOH A:947 , HOH A:983binding site for residue CIT A 513
08AC8SOFTWAREVAL A:317 , HOH A:861 , HOH A:1063 , HOH A:1074 , HOH A:1082 , HOH A:1106binding site for residue NA A 514
09AC9SOFTWARETHR A:307 , ASN A:414 , PRO A:417 , ASN A:418 , HOH A:648 , HOH A:704 , HOH A:712 , HOH A:723 , HOH A:742 , HOH A:750 , HOH A:803 , HOH A:811 , HOH A:1000 , HOH A:1041 , HOH A:1091binding site for Poly-Saccharide residues NAG A 508 through BMA A 510 bound to ASN A 414
10AD1SOFTWAREVAL A:331 , GLU A:385 , ASN A:436 , HOH A:647 , HOH A:701 , HOH A:728 , HOH A:820 , HOH A:842 , HOH A:1054binding site for Poly-Saccharide residues NAG A 505 through BMA A 507 bound to ASN A 436

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:86 -A:488
2A:118 -A:208

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Gly A:4 -Pro A:5
2Phe A:32 -Pro A:33
3Leu A:370 -Pro A:371
4Gly A:395 -Pro A:396

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5MHU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5MHU)

(-) Exons   (0, 0)

(no "Exon" information available for 5MHU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:499
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeeeee......eeeeee........eeee...eeeeeeee...hhhhh....eeee......hhhhh..............eeeeeee.....eeeeeee...hhhhhh.eeeeeee.....hhhhh...hhh.eeeeeee...hhhhh.........eeee................eeee....eeeeeeee......eeeee....eeeeee..eeeeeeee..eee....eeeeeee......eeeeeeee......hhhhh.eeeeee....................hhhhh..................eeee..eeee..eeee..........hhhhhhhh...hhhhh.....eeee....eeeee..........eeee....eeeee.............ee.eee........eeeee....eeeeeee.hhhhhhh..eeeeeehhhhhhhhh..hhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5mhu A   1 AQIGPVTDLHITNANISPDGFSRPAVLAGGTFPGPTIAGNTGDNFQITVFNDLTDPSMLTDTSIHWHGLFQKGTNWADGPAFVTQCPIITGQSFDYNFNVPGQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPNASLYDVDDDTTIITLADWYHTLAQQEPIGAAITADATLINGLGRSFTNTTASPLSVITVQSGKRYRMRLVSISCDPNYLFSIDGHDMTIIEVDGVNSQQLTVDQIQIFAAQRYSFVLNANQPVGNYWIRAQPNSGGQGFDGGINSAILRYEGATVEDPTTTAPTTFSNPLVETDLHPLADLGVPGQPFRGGADDPLVLNLAFANGRFSIDGVSFVPPTVPVLLQILSGAQNAQDLLPAGSVISLPSNSVIEVALPAGAAGGPHPFHLHGHNFAVVQSANNATPNYVNPIWRDTVSIGGTGDNVTIRFTTNNPGPWFLHCHIDWHLEAGFAIVFAEDIPDTASANPVPQAWSDLCPAYDQAHNIST 499
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5MHU)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5MHU)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5MHU)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CIT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OXY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:395 - Pro A:396   [ RasMol ]  
    Gly A:4 - Pro A:5   [ RasMol ]  
    Leu A:370 - Pro A:371   [ RasMol ]  
    Phe A:32 - Pro A:33   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5mhu
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  I1VE66_9APHY | I1VE66
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.10.3.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  I1VE66_9APHY | I1VE66
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        I1VE66_9APHY | I1VE66: 5mej 5mew 5mhv 5mhw 5mhx 5mhy 5mhz 5mi1 5mi2 5mia 5mib 5mic 5mid 5mie 5mig
UniProtKB/TrEMBL
        I1VE66_9APHY | I1VE66: 5e9n

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5MHU)