Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STECCHERINUM MURASHKINSKYI LACCASE AT 0.95 RESOLUTION
 
Authors :  K. M. Polyakov, O. A. Glazunova, T. V. Fedorova, O. V. Koroleva
Date :  15 Oct 15  (Deposition) - 23 Dec 15  (Release) - 23 Dec 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  0.95
Chains :  Asym./Biol. Unit :  A
Keywords :  Laccase, Oxidoreductase, Enzyme (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  O. A. Glazunova, K. M. Polyakov, T. V. Fedorova, O. A. Koroleva
Structures Of Two New Middle-Redoxpotential Laccases
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - LACCASE 2
    Chains: A
    EC Number: 1.10.3.2
    Fragment: UNP RESIDUES 20-546
    Organism Scientific: STECCHERINUM MURASHKINSKYI
    Organism Taxid: 627145

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 11)

Asymmetric/Biological Unit (4, 11)
No.NameCountTypeFull Name
1CU4Ligand/IonCOPPER (II) ION
2NA1Ligand/IonSODIUM ION
3NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE
4PG62Ligand/Ion1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:112 , HIS A:400 , HIS A:402 , HIS A:452 , HOH A:1125binding site for residue CU A 601
2AC2SOFTWAREHIS A:65 , HIS A:67 , TRP A:108 , HIS A:110 , HIS A:454 , HOH A:1125binding site for residue CU A 602
3AC3SOFTWAREHIS A:65 , HIS A:67 , HIS A:400 , HIS A:402 , HOH A:996binding site for residue CU A 603
4AC4SOFTWAREHIS A:397 , CYS A:453 , ILE A:455 , HIS A:458binding site for residue CU A 604
5AC5SOFTWAREVAL A:317 , HOH A:959 , HOH A:1144 , HOH A:1171 , HOH A:1243 , HOH A:1390binding site for residue NA A 605
6AC6SOFTWAREASN A:15 , GLY A:319 , GLN A:320 , ALA A:326 , ASP A:327 , HOH A:712 , HOH A:906binding site for residue PG6 A 610
7AC7SOFTWAREALA A:335 , PHE A:336 , ALA A:337 , ARG A:340 , PHE A:341 , SER A:342 , HOH A:708 , HOH A:1219 , HOH A:1281binding site for residue PG6 A 611
8AC8SOFTWARETHR A:307 , ASN A:414 , THR A:416 , PRO A:417 , ASN A:418 , HOH A:746 , HOH A:777 , HOH A:812 , HOH A:883 , HOH A:936 , HOH A:980 , HOH A:983 , HOH A:1094 , HOH A:1123 , HOH A:1172 , HOH A:1216binding site for Poly-Saccharide residues NAG A 608 through NAG A 609 bound to ASN A 414
9AC9SOFTWAREPRO A:329 , VAL A:331 , GLU A:385 , ASN A:436 , HOH A:750 , HOH A:827 , HOH A:843 , HOH A:1000 , HOH A:1004 , HOH A:1117binding site for Poly-Saccharide residues NAG A 606 through NAG A 607 bound to ASN A 436

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:86 -A:488
2A:118 -A:208

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Gly A:4 -Pro A:5
2Phe A:32 -Pro A:33
3Leu A:370 -Pro A:371
4Gly A:395 -Pro A:396

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5E9N)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5E9N)

(-) Exons   (0, 0)

(no "Exon" information available for 5E9N)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:495
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeeeee......eeeeee........eeee...eeeeeeee...hhhhh....eeee......hhhhh..............eeeeeee.....eeeeeee...hhhhhh.eeeeeee.....hhhhh...hhh.eeeeeee...hhhhh.........eeee................eeee....eeeeeeee......eeeee....eeeeee..eeeeeeee..eee....eeeeeee......eeeeeeee......hhhhh.eeeeee....................hhhhh..................eeee..eeee..eeee..........hhhhhhhh...hhhhh.....eeee....eeeee..........eeee....eeeee.............ee.eee........eeeee....eeeeeee.hhhhhhh..eeeeeehhhhhhhhh..hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5e9n A   1 AQIGPVTDLHITNANISPDGFSRPAVLAGGTFPGPTIAGNTGDNFQITVFNDLTDPSMLTDTSIHWHGLFQKGTNWADGPAFVTQCPIITGQSFDYNFNVPGQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPNASLYDVDDDTTIITLADWYHTLAQQEPIGAAITADATLINGLGRSFTNTTASPLSVITVQSGKRYRMRLVSISCDPNYLFSIDGHDMTIIEVDGVNSQQLTVDQIQIFAAQRYSFVLNANQPVGNYWIRAQPNSGGQGFDGGINSAILRYEGATVEDPTTTAPTTFSNPLVETDLHPLADLGVPGQPFRGGADDPLVLNLAFANGRFSIDGVSFVPPTVPVLLQILSGAQNAQDLLPAGSVISLPSNSVIEVALPAGAAGGPHPFHLHGHNFAVVQSANNATPNYVNPIWRDTVSIGGTGDNVTIRFTTNNPGPWFLHCHIDWHLEAGFAIVFAEDIPDTASANPVPQAWSDLCPAYDQAH 495
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5E9N)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5E9N)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5E9N)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PG6  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:395 - Pro A:396   [ RasMol ]  
    Gly A:4 - Pro A:5   [ RasMol ]  
    Leu A:370 - Pro A:371   [ RasMol ]  
    Phe A:32 - Pro A:33   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5e9n
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  I1VE66_9APHY | I1VE66
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.10.3.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  I1VE66_9APHY | I1VE66
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        I1VE66_9APHY | I1VE66: 5mej 5mew 5mhu 5mhv 5mhw 5mhx 5mhy 5mhz 5mi1 5mi2 5mia 5mib 5mic 5mid 5mie 5mig

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5E9N)