Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  HDM2 IN COMPLEX WITH A 3,3-DISUBSTITUTED PIPERIDINE
 
Authors :  G. Scapin
Date :  16 Jan 16  (Deposition) - 06 Apr 16  (Release) - 06 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.17
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  A,B  (1x)
Keywords :  Oncology, E3 Ubiquitin-Protein Ligase, P53/Tp53, Ligase-Ligase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. L. Bogen, W. Pan, C. R. Gibeau, B. R. Lahue, Y. Ma, L. G. Nair, E. Seigel G. W. Shipps, Y. Tian, Y. Wang, Y. Lin, M. Liu, S. Liu, A. Mirza, X. Wang, P. Lipari, C. Seidel-Dugan, D. J. Hicklin, W. R. Bishop, D. Rindgen, A. Nomeir, W. Prosise, P. Reichert, G. Scapin, C. Strickland, R. J. Dol
Discovery Of Novel 3, 3-Disubstituted Piperidines As Orally Bioavailable, Potent, And Efficacious Hdm2-P53 Inhibitors.
Acs Med. Chem. Lett. V. 7 324 2016
PubMed-ID: 26985323  |  Reference-DOI: 10.1021/ACSMEDCHEMLETT.5B00472

(-) Compounds

Molecule 1 - E3 UBIQUITIN-PROTEIN LIGASE MDM2
    Chains: A, B
    EC Number: 6.3.2.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: MDM2
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: DOUBLE MINUTE 2 PROTEIN,HDM2,ONCOPROTEIN MDM2,P53-BINDING PROTEIN MDM2

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B
Biological Unit 3 (1x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
162Q2Ligand/Ion{4-[2-(2-HYDROXYETHOXY)PHENYL]PIPERAZIN-1-YL}[(2R,3S)-2-PROPYL-3-[4-(TRIFLUOROMETHYL)PHENOXY]-1-{[4-(TRIFLUOROMETHYL)PYRIDIN-3-YL]CARBONYL}PIPERIDIN-3-YL]METHANONE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
162Q1Ligand/Ion{4-[2-(2-HYDROXYETHOXY)PHENYL]PIPERAZIN-1-YL}[(2R,3S)-2-PROPYL-3-[4-(TRIFLUOROMETHYL)PHENOXY]-1-{[4-(TRIFLUOROMETHYL)PYRIDIN-3-YL]CARBONYL}PIPERIDIN-3-YL]METHANONE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
162Q1Ligand/Ion{4-[2-(2-HYDROXYETHOXY)PHENYL]PIPERAZIN-1-YL}[(2R,3S)-2-PROPYL-3-[4-(TRIFLUOROMETHYL)PHENOXY]-1-{[4-(TRIFLUOROMETHYL)PYRIDIN-3-YL]CARBONYL}PIPERIDIN-3-YL]METHANONE
Biological Unit 3 (1, 2)
No.NameCountTypeFull Name
162Q2Ligand/Ion{4-[2-(2-HYDROXYETHOXY)PHENYL]PIPERAZIN-1-YL}[(2R,3S)-2-PROPYL-3-[4-(TRIFLUOROMETHYL)PHENOXY]-1-{[4-(TRIFLUOROMETHYL)PYRIDIN-3-YL]CARBONYL}PIPERIDIN-3-YL]METHANONE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:54 , LEU A:57 , GLY A:58 , ILE A:61 , MET A:62 , TYR A:67 , GLN A:72 , PHE A:91 , VAL A:93 , HIS A:96 , ILE A:99 , TYR A:100 , LYS B:51 , 62Q B:1001binding site for residue 62Q A 1001
2AC2SOFTWARELYS A:51 , GLU A:52 , TYR A:55 , 62Q A:1001 , GLN B:24 , LEU B:54 , LEU B:57 , GLY B:58 , ILE B:61 , MET B:62 , TYR B:67 , GLN B:72 , PHE B:91 , VAL B:93 , HIS B:96 , ILE B:99 , TYR B:100binding site for residue 62Q B 1001

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5HMK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5HMK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5HMK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5HMK)

(-) Exons   (0, 0)

(no "Exon" information available for 5HMK)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:86
                                                                                                                      
               SCOP domains -------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeehhhhhhhhhh.......eehhhhhhhhhhhhhhhh........eee...hhhhhhhh..eee..hhhhhhhhhhh.eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------- Transcript
                 5hmk A  26 TLVRPKPLLLKLLKSVGAQKDTYTMKEVLYYLGQYIMTKRLYDEKQQHIVHCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN 111
                                    35        45        55        65        75        85        95       105      


Chain B from PDB  Type:PROTEIN  Length:91
                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeehhhhhhhhhh.......eehhhhhhhhhhhhhhh..ee..eeeeee...hhhhhhhh..eee..hhhhhhhhhhh.eee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 5hmk B  21 ASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLYYLGQYIMTKRLYDEKQQHIVHCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN 111
                                    30        40        50        60        70        80        90       100       110
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5HMK)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5HMK)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5HMK)

(-) Gene Ontology  (83, 83)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    62Q  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5hmk)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5hmk
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MDM2_HUMAN | Q00987
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.3.2.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MDM2_HUMAN | Q00987
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MDM2_HUMAN | Q00987: 1rv1 1t4e 1t4f 1ycr 1z1m 2axi 2c6a 2c6b 2f1y 2fop 2gv2 2hdp 2lzg 2m86 2mps 2ruh 2vje 2vjf 3eqs 3g03 3iux 3iwy 3jzk 3jzr 3jzs 3lbk 3lbl 3lnj 3lnz 3mqs 3tj2 3tpx 3tu1 3v3b 3vbg 3vzv 3w69 4dij 4ere 4erf 4hbm 4hfz 4hg7 4jv7 4jv9 4jve 4jvr 4jwr 4mdn 4mdq 4oas 4oba 4occ 4ode 4odf 4ogn 4ogt 4ogv 4oq3 4qo4 4qoc 4ud7 4ue1 4umn 4wt2 4xxb 4zfi 4zgk 4zyc 4zyf 4zyi 5afg 5c5a 5hmh 5hmi 5j7f 5j7g 5lav 5law 5lay 5laz 5ln2 5mnj 5trf

(-) Related Entries Specified in the PDB File

5hmh 5hmi