Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF T94I RHODOPSIN MUTANT
 
Authors :  A. Singhal, Y. Guo, M. Matkovic, G. Schertler, X. Deupi, E. Yan, J. Stand
Date :  08 Nov 15  (Deposition) - 10 Aug 16  (Release) - 19 Oct 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.81
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Rhodopsin, G Protein-Coupled Receptors, Congenital Stationary Night Blindness, Constitutive Activity, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Singhal, Y. Guo, M. Matkovic, G. Schertler, X. Deupi, E. C. Yan, J. Standfuss
Structural Role Of The T94I Rhodopsin Mutation In Congenita Stationary Night Blindness.
Embo Rep. V. 17 1431 2016
PubMed-ID: 27458239  |  Reference-DOI: 10.15252/EMBR.201642671

(-) Compounds

Molecule 1 - RHODOPSIN
    ChainsA
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHEK293S GNTI-
    Expression System CommonHUMAN
    Expression System PlasmidPCMV-TET O
    Expression System Taxid9606
    GeneRHO
    MutationYES
    Organism CommonBOVINE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
 
Molecule 2 - GUANINE NUCLEOTIDE-BINDING PROTEIN G(T) SUBUNIT ALPHA-3
    ChainsB
    EngineeredYES
    FragmentUNP RESIDUES 344-354
    Organism CommonBOVINE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    Other DetailsGUANINE NUCLEOTIDE-BINDING PROTEIN G(T) SUBUNIT ALPHA- 3 PEPTIDE
    SynonymGUSTDUCIN ALPHA-3 CHAIN
    SyntheticYES

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (9, 13)

Asymmetric/Biological Unit (9, 13)
No.NameCountTypeFull Name
1ACE1Mod. Amino AcidACETYL GROUP
2ACT2Ligand/IonACETATE ION
3BMA1Ligand/IonBETA-D-MANNOSE
4BOG2Ligand/IonB-OCTYLGLUCOSIDE
5MAN1Ligand/IonALPHA-D-MANNOSE
6NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
7PLM2Ligand/IonPALMITIC ACID
8RET1Ligand/IonRETINAL
9SO41Ligand/IonSULFATE ION

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA A:117 , GLU A:122 , MET A:207 , TRP A:265 , TYR A:268 , ALA A:269 , ALA A:272 , LYS A:296binding site for residue RET A 401
2AC2SOFTWAREVAL A:204 , ILE A:205 , PHE A:273binding site for residue ACT A 402
3AC3SOFTWAREGLU A:150binding site for residue ACT A 403
4AC4SOFTWAREPHE A:220 , THR A:251 , VAL A:254binding site for residue BOG A 404
5AC5SOFTWAREPRO A:53 , ILE A:54 , MET A:309 , VAL A:318 , CYS A:322binding site for residue PLM A 405
6AC6SOFTWAREARG A:252 , VAL A:300 , LEU A:321 , CYS A:323binding site for residue PLM A 406
7AC7SOFTWAREPRO A:27 , TYR A:29 , GLU A:33 , TRP A:35 , TYR A:96 , LEU A:99 , HIS A:100binding site for residue BOG A 411
8AC8SOFTWAREGLY A:284 , PRO A:285 , ILE A:286 , PHE A:287binding site for residue SO4 A 412
9AC9SOFTWARETHR A:4 , ASN A:15 , GLY A:18 , VAL A:20 , ARG A:21 , GLU A:25 , HOH A:509binding site for Poly-Saccharide residues NAG A 407 through MAN A 410 bound to ASN A 15

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:2 -A:282
2A:110 -A:187

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5EN0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5EN0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5EN0)

(-) Exons   (0, 0)

(no "Exon" information available for 5EN0)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:327
                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee..eee.....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhh....eeee....eeee.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5en0 A   0 xMCGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTILYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSCFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKN 326
                            |        9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       
                            |                                                                                                                                                                                                                                                                                                                                      
                            0-ACE                                                                                                                                                                                                                                                                                                                                  

Chain B from PDB  Type:PROTEIN  Length:11
                                           
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author .hhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------- SAPs(SNPs)
                    PROSITE ----------- PROSITE
                 Transcript ----------- Transcript
                 5en0 B 340 ILENLKDVGLF 350
                                   349 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5EN0)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5EN0)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5EN0)

(-) Gene Ontology  (47, 51)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BOG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PLM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    RET  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5en0)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5en0
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GNAT3_BOVIN | P0C7Q4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  OPSD_BOVIN | P02699
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GNAT3_BOVIN | P0C7Q4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  OPSD_BOVIN | P02699
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GNAT3_BOVIN | P0C7Q44a4m
        OPSD_BOVIN | P026991boj 1bok 1eds 1edv 1edw 1edx 1f88 1fdf 1gzm 1hzx 1jfp 1l9h 1ln6 1n3m 1nzs 1ov0 1ov1 1u19 1vqx 1y6y 2g87 2hpy 2i35 2i36 2i37 2iqk 2j4y 2ped 2x72 3c9l 3c9m 3cap 3dqb 3oax 3pqr 3pxo 4a4m 4bey 4bez 4j4q 4pxf 4x1h 5dys 5te3 5te5

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5EN0)