5EA9 - JenaLib

Asymmetric Unit (30, 30)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	SER A:44 , CYS A:45 , ASN A:67 , MET A:69 , GLY A:70 , LEU A:71 , PRO A:72 , ASN A:73 , SER A:99 , ASN A:127 , CYS A:130 , ASN A:132 , ASN A:194 , SER A:195 , FMN A:409 , HOH A:569	binding site for residue 5LM A 401
02	AC2	SOFTWARE	ILE A:171 , ARG A:239 , HOH A:599 , HOH A:671 , LYS B:214 , GLN B:215 , PHE B:217 , HOH B:509 , HOH B:608	binding site for residue GOL A 402
03	AC3	SOFTWARE	PHE A:61 , ASP A:203 , HOH A:562 , HOH A:612 , HOH A:669	binding site for residue GOL A 403
04	AC4	SOFTWARE	GOL A:408 , HOH A:524 , HOH A:543	binding site for residue GOL A 404
05	AC5	SOFTWARE	ASP A:175 , THR A:176 , HOH A:645 , LEU B:80 , ARG B:112 , HOH B:573 , HOH B:612	binding site for residue GOL A 405
06	AC6	SOFTWARE	LEU A:4 , ASN A:5 , GLU A:302 , ARG A:305 , HOH A:552 , HOH A:574 , HOH A:666 , LYS B:3 , ASN B:5	binding site for residue GOL A 406
07	AC7	SOFTWARE	TYR A:237 , PRO A:241	binding site for residue GOL A 407
08	AC8	SOFTWARE	LEU A:22 , ASP A:28 , GOL A:404 , HOH A:502 , HOH A:503 , HOH A:511 , HOH A:537 , HOH A:704	binding site for residue GOL A 408
09	AC9	SOFTWARE	ALA A:18 , ALA A:19 , GLY A:20 , LYS A:43 , SER A:44 , ASN A:67 , ASN A:127 , LYS A:164 , VAL A:193 , ASN A:194 , SER A:195 , GLY A:221 , GLY A:222 , ILE A:225 , CYS A:248 , GLY A:249 , GLY A:250 , GLY A:271 , THR A:272 , 5LM A:401 , HOH A:522 , HOH A:548 , HOH A:553 , HOH A:564	binding site for residue FMN A 409
10	AD1	SOFTWARE	LEU A:63 , LYS A:223 , HOH A:520 , HOH A:531 , HOH A:593 , LEU B:63	binding site for residue EDO A 410
11	AD2	SOFTWARE	LEU A:74 , GLY A:75 , ASP A:77 , PHE A:78 , HOH A:518	binding site for residue EDO A 411
12	AD3	SOFTWARE	TYR A:252 , ALA A:273 , GLU A:276 , GLU A:277 , ARG A:284 , HOH A:514 , HOH A:521 , HOH A:561	binding site for residue EDO A 412
13	AD4	SOFTWARE	VAL A:10 , PRO A:93 , HOH A:506 , HOH A:525 , ARG B:299 , THR B:300	binding site for residue EDO A 413
14	AD5	SOFTWARE	GLY A:278 , PRO A:279 , HOH A:643 , GLY B:278 , PRO B:279 , NCO B:409 , HOH B:656	binding site for residue EDO A 414
15	AD6	SOFTWARE	LYS A:214 , GLN A:215 , PHE A:217 , ILE B:171 , ARG B:238 , ARG B:239 , HOH B:543 , HOH B:620 , HOH B:699	binding site for residue GOL B 402
16	AD7	SOFTWARE	HIS A:173 , TYR B:141 , TYR B:168 , PHE B:169 , HIS B:173 , HOH B:502 , HOH B:505	binding site for residue GOL B 403
17	AD8	SOFTWARE	ARG A:112 , THR B:176 , HOH B:542	binding site for residue GOL B 404
18	AD9	SOFTWARE	ILE A:171 , ALA A:172 , HOH A:576 , PRO B:115 , GLY B:135 , PRO B:137 , EDO B:413 , HOH B:506 , HOH B:522 , HOH B:529	binding site for residue GOL B 405
19	AE1	SOFTWARE	TYR B:58 , HOH B:508 , HOH B:515	binding site for residue GOL B 406
20	AE2	SOFTWARE	CYS A:31 , ALA A:34 , SER A:35 , CYS B:31 , ALA B:34 , SER B:35 , HOH B:615 , HOH B:638	binding site for residue GOL B 407
21	AE3	SOFTWARE	ALA B:18 , ALA B:19 , GLY B:20 , LYS B:43 , SER B:44 , ASN B:67 , ASN B:127 , LYS B:164 , VAL B:193 , ASN B:194 , GLY B:221 , GLY B:222 , ILE B:225 , CYS B:248 , GLY B:249 , GLY B:250 , GLY B:271 , THR B:272 , 5LM B:401 , HOH B:526 , HOH B:537 , HOH B:553 , HOH B:618	binding site for residue FMN B 408
22	AE4	SOFTWARE	GLN A:275 , GLU A:276 , GLY A:278 , EDO A:414 , GLN B:275 , GLU B:276 , GLY B:278 , HOH B:689 , HOH B:692	binding site for residue NCO B 409
23	AE5	SOFTWARE	ASP A:203 , ASP B:203	binding site for residue NCO B 410
24	AE6	SOFTWARE	HOH A:531 , LEU B:63 , LYS B:223 , HOH B:636 , HOH B:747	binding site for residue EDO B 411
25	AE7	SOFTWARE	ALA B:273 , GLU B:276 , GLU B:277 , ARG B:284 , HOH B:524 , HOH B:533 , HOH B:575	binding site for residue EDO B 412
26	AE8	SOFTWARE	ARG B:111 , ALA B:114 , PRO B:115 , ALA B:156 , GOL B:405 , HOH B:517	binding site for residue EDO B 413
27	AE9	SOFTWARE	PHE B:61 , HOH B:511 , HOH B:605 , HOH B:635	binding site for residue EDO B 414
28	AF1	SOFTWARE	THR B:25 , LEU B:74 , HOH B:504 , HOH B:528 , HOH B:550 , HOH B:591 , HOH B:599	binding site for residue EDO B 415
29	AF2	SOFTWARE	ARG B:30 , THR B:33 , TYR B:82 , HIS B:87 , ASP B:88 , HOH B:597	binding site for residue EDO B 416
30	AF3	SOFTWARE	SER B:44 , CYS B:45 , THR B:46 , ASN B:67 , MET B:69 , GLY B:70 , LEU B:71 , PRO B:72 , ASN B:73 , SER B:99 , ASN B:127 , SER B:129 , PRO B:131 , ASN B:132 , GLN B:138 , ASN B:194 , SER B:195 , FMN B:408 , HOH B:551 , HOH B:559 , HOH B:627	binding site for Di-peptide 5LM B 401 and CYS B 130

SS Bonds (1, 1)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:313
                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee..eee...eee.......hhhhhhhhhhh....ee................eeee..eeee.......hhhhhhhhhhhh.......eeeee...hhhhhhhhhhhhhhhhhhhh.eeeee..........hhhhhhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhhhhh...eeeeee...eeeee.ee....ee..hhhh.eeeeehhhhhhhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhh...eeehhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ea9 A   0 MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE 312
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309

Chain B from PDB  Type:PROTEIN  Length:313
                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee..eee...eee.......hhhhhhhhhhh....ee................eeee..eeee.......hhhhhhhhhhhh.......eeeee...hhhhhhhhhhhhhhhhhhhh.eeeee..........hhhhhhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhhhhh...eeeeee...eeeee.ee....ee..hhhh.eeeeehhhhhhhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhh...eeehhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ea9 B   0 MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE 312
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (10, 10)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		5LM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FMN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NCO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]
		AD7	[ RasMol ]	+environment [ RasMol ]
		AD8	[ RasMol ]	+environment [ RasMol ]
		AD9	[ RasMol ]	+environment [ RasMol ]
		AE1	[ RasMol ]	+environment [ RasMol ]
		AE2	[ RasMol ]	+environment [ RasMol ]
		AE3	[ RasMol ]	+environment [ RasMol ]
		AE4	[ RasMol ]	+environment [ RasMol ]
		AE5	[ RasMol ]	+environment [ RasMol ]
		AE6	[ RasMol ]	+environment [ RasMol ]
		AE7	[ RasMol ]	+environment [ RasMol ]
		AE8	[ RasMol ]	+environment [ RasMol ]
		AE9	[ RasMol ]	+environment [ RasMol ]
		AF1	[ RasMol ]	+environment [ RasMol ]
		AF2	[ RasMol ]	+environment [ RasMol ]
		AF3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Cys A:192 - Val A:193	[ RasMol ]
		Cys B:192 - Val B:193	[ RasMol ]
		Glu A:55 - Pro A:56	[ RasMol ]
		Glu B:55 - Pro B:56	[ RasMol ]

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (5, 30)

Sites (30, 30)

SS Bonds (1, 1)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File