4ZRV - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   STRUCTURE OF COW MINCLE CRD COMPLEXED WITH TREHALOSE MONO BUTYRATE

Authors :   H. Feinberg, N. D. S. Rambaruth, M. E. Taylor, K. Drickamer, W. I. Weis

Date :   12 May 15 (Deposition) - 25 May 16 (Release) - 19 Oct 16 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym. Unit : A,B,C
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: A,B,C  (1x)

Keywords :   Glycobiology, Carbohydrate-Binding Protein, C-Type Lectin, Complex, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Feinberg, N. D. Rambaruth, S. A. Jegouzo, K. M. Jacobsen, R. Djurhuus, T. B. Poulsen, W. I. Weis, M. E. Taylor, K. Drickamer
Binding Sites For Acylated Trehalose Analogs Of Glycolipid Ligands On An Extended Carbohydrate Recognition Domain Of The Macrophage Receptor Mincle.
J. Biol. Chem. V. 291 21222 2016
PubMed-ID: 27542410 | Reference-DOI: 10.1074/JBC.M116.749515

Molecule 1 - MINCLE CRD
	Chains	:	A, B, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	UNP RESIDUES 79-208
	Gene	:	CLEC4E
	Organism Common	:	BOVINE
	Organism Scientific	:	BOS TAURUS
	Organism Taxid	:	9913

		1	2	3
Asymmetric Unit	:	A	B	C
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:	A	B	C

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 15)

No.	Name	Count	Type	Full Name
1	4RS	3	Ligand/Ion	TREHALOSE MONO-BUTYRATE
2	ACT	3	Ligand/Ion	ACETATE ION
3	CA	9	Ligand/Ion	CALCIUM ION

Biological Unit 1 (2, 2)

No.	Name	Count	Type	Full Name
1	4RS	1	Ligand/Ion	TREHALOSE MONO-BUTYRATE
2	ACT	1	Ligand/Ion	ACETATE ION
3	CA	-1	Ligand/Ion	CALCIUM ION

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	4RS	1	Ligand/Ion	TREHALOSE MONO-BUTYRATE
2	ACT	-1	Ligand/Ion	ACETATE ION
3	CA	-1	Ligand/Ion	CALCIUM ION

Biological Unit 3 (2, 3)

No.	Name	Count	Type	Full Name
1	4RS	1	Ligand/Ion	TREHALOSE MONO-BUTYRATE
2	ACT	2	Ligand/Ion	ACETATE ION
3	CA	-1	Ligand/Ion	CALCIUM ION

Biological Unit 4 (2, 6)

No.	Name	Count	Type	Full Name
1	4RS	3	Ligand/Ion	TREHALOSE MONO-BUTYRATE
2	ACT	3	Ligand/Ion	ACETATE ION
3	CA	-1	Ligand/Ion	CALCIUM ION

Asymmetric Unit (15, 15)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	GLU A:135 , GLU A:168 , ASN A:170 , GLU A:176 , ARG A:182 , ASN A:192 , ASP A:193 , PHE A:198 , CA A:302 , HOH A:413 , HOH A:467	binding site for residue 4RS A 301
02	AC2	SOFTWARE	GLU A:168 , ASN A:170 , GLU A:176 , ASN A:192 , ASP A:193 , 4RS A:301	binding site for residue CA A 302
03	AC3	SOFTWARE	VAL A:116 , ASN A:118 , GLU A:122 , GLU A:205 , HOH A:483 , HOH A:502	binding site for residue CA A 303
04	AC4	SOFTWARE	ASP A:142 , GLU A:146 , ASN A:171 , GLU A:176 , ASP A:177 , HOH A:463	binding site for residue CA A 304
05	AC5	SOFTWARE	ASP A:142 , GLU A:146 , ASP A:177 , HOH A:402 , HOH A:405 , HOH A:409 , HOH A:414 , ASP B:142 , GLU B:146 , THR B:174 , ASP B:177 , HOH B:401 , HOH B:446	binding site for residue ACT A 305
06	AC6	SOFTWARE	GLU B:168 , ASN B:170 , LEU B:172 , GLU B:176 , ASN B:192 , ASP B:193 , CA B:302 , HOH B:404 , HOH B:406 , HOH B:411 , PHE C:197 , PHE C:198 , ASN C:199 , ACT C:301	binding site for residue 4RS B 301
07	AC7	SOFTWARE	GLU B:168 , ASN B:170 , GLU B:176 , ASN B:192 , ASP B:193 , 4RS B:301	binding site for residue CA B 302
08	AC8	SOFTWARE	VAL B:116 , ASN B:118 , GLU B:122 , GLU B:205 , HOH B:484 , HOH B:492	binding site for residue CA B 303
09	AC9	SOFTWARE	ASP B:142 , GLU B:146 , ASN B:171 , GLU B:176 , ASP B:177 , HOH B:433	binding site for residue CA B 304
10	AD1	SOFTWARE	4RS B:301 , ASN C:199	binding site for residue ACT C 301
11	AD2	SOFTWARE	VAL A:173 , PHE B:197 , PHE B:198 , GLU C:135 , GLU C:168 , ASN C:170 , GLU C:176 , ARG C:182 , ASN C:192 , ASP C:193 , PHE C:198 , CA C:303 , HOH C:403 , HOH C:431	binding site for residue 4RS C 302
12	AD3	SOFTWARE	GLU C:168 , ASN C:170 , GLU C:176 , ASN C:192 , ASP C:193 , 4RS C:302	binding site for residue CA C 303
13	AD4	SOFTWARE	VAL C:116 , ASN C:118 , GLU C:122 , GLU C:205 , HOH C:429 , HOH C:459	binding site for residue CA C 304
14	AD5	SOFTWARE	ASP C:142 , GLU C:146 , ASN C:171 , GLU C:176 , ASP C:177 , HOH C:430	binding site for residue CA C 305
15	AD6	SOFTWARE	ASP C:142 , GLU C:146 , ASN C:171 , THR C:174 , ASP C:177 , HOH C:428 , HOH C:444	binding site for residue ACT C 306

Asymmetric Unit

No.	Residues
1	A:79	-	A:90
2	A:107	-	A:204
3	A:178	-	A:196
4	B:79	-	B:90
5	B:107	-	B:204
6	B:178	-	B:196
7	C:79	-	C:90
8	C:107	-	C:204
9	C:178	-	C:196

Asymmetric Unit

No.	Residues
1	Glu A:168	-	Pro A:169
2	Glu B:168	-	Pro B:169
3	Glu C:168	-	Pro C:169

(no "SAP(SNP)/Variant" information available for 4ZRV)

(no "PROSITE Motif" information available for 4ZRV)

(no "Exon" information available for 4ZRV)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:132
                                                                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhh.....eeeeee........ee......hhhhh........hhhhh..eeee.........eeee......eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4zrv A  78 ACPLKWFHFQSSCYLFSPDTMSWRASLKNCSSMGAHLVVINTQEEQEFLYYTKPRKKEFYIGLTDQVTEGQWQWVDGTPFTKSLSFWDAGEPNNLVTVEDCATIRDSSNPRQNWNDVPCFFNMFRVCEMPER 209
                                    87        97       107       117       127       137       147       157       167       177       187       197       207

Chain B from PDB  Type:PROTEIN  Length:131
                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhh.....eeeeee........ee...................hhhhh..eeee.........eeee......eeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zrv B  78 ACPLKWFHFQSSCYLFSPDTMSWRASLKNCSSMGAHLVVINTQEEQEFLYYTKPRKKEFYIGLTDQVTEGQWQWVDGTPFTKSLSFWDAGEPNNLVTVEDCATIRDSSNPRQNWNDVPCFFNMFRVCEMPE 208
                                    87        97       107       117       127       137       147       157       167       177       187       197       207

Chain C from PDB  Type:PROTEIN  Length:131
                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhh.....eeeeee........ee......hhhhh........hhhh.eeeeee.........eeeee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4zrv C  78 ACPLKWFHFQSSCYLFSPDTMSWRASLKNCSSMGAHLVVINTQEEQEFLYYTKPRKKEFYIGLTDQVTEGQWQWVDGTPFTKSLSFWDAGEPNNLVTVEDCATIRDSSNPRQNWNDVPCFFNMFRVCEMPE 208
                                    87        97       107       117       127       137       147       157       167       177       187       197       207

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 4ZRV)

(no "CATH Domain" information available for 4ZRV)

(no "Pfam Domain" information available for 4ZRV)

Asymmetric Unit(hide GO term definitions)

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		4RS	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ACT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Glu A:168 - Pro A:169	[ RasMol ]
		Glu B:168 - Pro B:169	[ RasMol ]
		Glu C:168 - Pro C:169	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	4zrv
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	E1BHM0_BOVIN \| E1BHM0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	E1BHM0_BOVIN \| E1BHM0
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/TrEMBL
	E1BHM0_BOVIN \| E1BHM0	:	4kzv 4kzw 4zrw 5kth 5kti

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 15)

Sites (15, 15)

SS Bonds (9, 9)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File