4XRZ - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   HUMAN CYTOCHROME P450 2D6 BACE1 INHIBITOR 6 COMPLEX

Authors :   E. F. Johnson, Y. Fan

Date :   21 Jan 15 (Deposition) - 20 May 15 (Release) - 20 May 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Cyp2D6, P450 2D6, Cytochrome P450, Monooxygenase, Oxidoreductase- Oxidoreductase Inhibitor Complex, Bace1 (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. A. Brodney, E. M. Beck, C. R. Butler, G. Barreiro, E. F. Johnson, D. Riddell, K. Parris, C. E. Nolan, Y. Fan, K. Atchison, C. Gonzales, A. E. Robshaw, S. D. Doran, M. W. Bundesmann, L. Buzon, J. Dutra, K. Henegar, E. Lachapelle, X. Hou, B. N. Rogers, J. Pandit, R. Lira, L. Martinez-Alsina, P. Mikochik, J. C. Murray, K. Ogilvie, L. Price, S. M. Sakya, A. Yu, Y. Zhang, B. T. O'Neill
Utilizing Structures Of Cyp2D6 And Bace1 Complexes To Reduc Risk Of Drug-Drug Interactions With A Novel Series Of Centrally Efficacious Bace1 Inhibitors.
J. Med. Chem. V. 58 3223 2015
PubMed-ID: 25781223 | Reference-DOI: 10.1021/ACS.JMEDCHEM.5B00191

Molecule 1 - CYTOCHROME P450 2D6
	Chains	:	A, B, C, D
	EC Number	:	1.14.14.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PCWORI
	Expression System Strain	:	DH5ALPHA
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 34-497
	Gene	:	CYP2D6, CYP2DL1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CYPIID6,CYTOCHROME P450-DB1,DEBRISOQUINE 4-HYDROXYLASE

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (5, 28)

No.	Name	Count	Type	Full Name
1	GOL	4	Ligand/Ion	GLYCEROL
2	HEM	4	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE
3	NA	4	Ligand/Ion	SODIUM ION
4	SI6	4	Ligand/Ion	(4AR,6R,8AS)-8A-(2,4-DIFLUOROPHENYL)-6-(1H-PYRAZOL-4-YL)-4,4A,5,6,8,8A-HEXAHYDROPYRANO[3,4-D][1,3]THIAZIN-2-AMINE
5	ZN	12	Ligand/Ion	ZINC ION

Biological Unit 1 (3, 3)

No.	Name	Count	Type	Full Name
1	GOL	1	Ligand/Ion	GLYCEROL
2	HEM	1	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE
3	NA	-1	Ligand/Ion	SODIUM ION
4	SI6	1	Ligand/Ion	(4AR,6R,8AS)-8A-(2,4-DIFLUOROPHENYL)-6-(1H-PYRAZOL-4-YL)-4,4A,5,6,8,8A-HEXAHYDROPYRANO[3,4-D][1,3]THIAZIN-2-AMINE
5	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 2 (3, 3)

No.	Name	Count	Type	Full Name
1	GOL	1	Ligand/Ion	GLYCEROL
2	HEM	1	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE
3	NA	-1	Ligand/Ion	SODIUM ION
4	SI6	1	Ligand/Ion	(4AR,6R,8AS)-8A-(2,4-DIFLUOROPHENYL)-6-(1H-PYRAZOL-4-YL)-4,4A,5,6,8,8A-HEXAHYDROPYRANO[3,4-D][1,3]THIAZIN-2-AMINE
5	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 3 (3, 3)

No.	Name	Count	Type	Full Name
1	GOL	1	Ligand/Ion	GLYCEROL
2	HEM	1	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE
3	NA	-1	Ligand/Ion	SODIUM ION
4	SI6	1	Ligand/Ion	(4AR,6R,8AS)-8A-(2,4-DIFLUOROPHENYL)-6-(1H-PYRAZOL-4-YL)-4,4A,5,6,8,8A-HEXAHYDROPYRANO[3,4-D][1,3]THIAZIN-2-AMINE
5	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 4 (3, 3)

No.	Name	Count	Type	Full Name
1	GOL	1	Ligand/Ion	GLYCEROL
2	HEM	1	Ligand/Ion	PROTOPORPHYRIN IX CONTAINING FE
3	NA	-1	Ligand/Ion	SODIUM ION
4	SI6	1	Ligand/Ion	(4AR,6R,8AS)-8A-(2,4-DIFLUOROPHENYL)-6-(1H-PYRAZOL-4-YL)-4,4A,5,6,8,8A-HEXAHYDROPYRANO[3,4-D][1,3]THIAZIN-2-AMINE
5	ZN	-1	Ligand/Ion	ZINC ION

Asymmetric Unit (28, 28)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ARG A:101 , VAL A:119 , PHE A:120 , TRP A:128 , ARG A:132 , ILE A:186 , THR A:309 , THR A:313 , GLN A:364 , VAL A:374 , HIS A:376 , LEU A:399 , PRO A:435 , PHE A:436 , SER A:437 , ARG A:441 , CYS A:443 , LEU A:444 , GLY A:445 , SI6 A:602 , HOH A:725	binding site for residue HEM A 601
02	AC2	SOFTWARE	PHE A:120 , ALA A:209 , GLY A:212 , LEU A:213 , GLU A:216 , GLN A:244 , ASP A:301 , SER A:304 , ALA A:305 , VAL A:308 , THR A:309 , PHE A:483 , HEM A:601	binding site for residue SI6 A 602
03	AC3	SOFTWARE	CYS A:191 , HIS A:258 , ASP A:270 , GLU A:273 , GLU C:287	binding site for residue ZN A 603
04	AC4	SOFTWARE	HIS A:463	binding site for residue ZN A 604
05	AC5	SOFTWARE	ASP A:422 , HIS A:426 , ASP B:422 , HIS B:426	binding site for residue ZN A 605
06	AC6	SOFTWARE	GLN A:244 , ASP A:301 , HOH A:714	binding site for residue GOL A 606
07	AC7	SOFTWARE	HIS A:324 , HOH A:721 , HOH A:778	binding site for residue ZN A 607
08	AC8	SOFTWARE	GLU A:446 , HOH A:720 , HOH A:752 , HOH A:764	binding site for residue NA A 608
09	AC9	SOFTWARE	ARG B:101 , VAL B:119 , PHE B:120 , TRP B:128 , ARG B:132 , ILE B:186 , THR B:309 , THR B:313 , VAL B:374 , HIS B:376 , LEU B:399 , PRO B:435 , PHE B:436 , SER B:437 , ARG B:441 , CYS B:443 , LEU B:444 , GLY B:445 , LEU B:448 , SI6 B:602 , HOH B:724	binding site for residue HEM B 601
10	AD1	SOFTWARE	PHE B:120 , ALA B:209 , GLY B:212 , LEU B:213 , GLU B:216 , ASP B:301 , SER B:304 , ALA B:305 , VAL B:308 , THR B:309 , PHE B:483 , HEM B:601 , GOL B:605	binding site for residue SI6 B 602
11	AD2	SOFTWARE	HIS B:258 , ASP B:270 , GLU B:273 , GLU B:287	binding site for residue ZN B 603
12	AD3	SOFTWARE	HIS B:463 , HOH B:727 , HOH B:738	binding site for residue ZN B 604
13	AD4	SOFTWARE	LEU B:121 , GLU B:216 , ASP B:301 , SI6 B:602 , HOH B:778	binding site for residue GOL B 605
14	AD5	SOFTWARE	GLY B:118 , VAL B:119 , PHE B:120 , ASP B:301	binding site for residue NA B 606
15	AD6	SOFTWARE	ARG C:101 , VAL C:119 , PHE C:120 , TRP C:128 , ARG C:132 , THR C:309 , THR C:313 , GLN C:364 , VAL C:374 , HIS C:376 , LEU C:399 , PRO C:435 , PHE C:436 , SER C:437 , ARG C:441 , CYS C:443 , LEU C:444 , GLY C:445 , LEU C:448 , SI6 C:602 , HOH C:731	binding site for residue HEM C 601
16	AD7	SOFTWARE	PHE C:120 , ALA C:209 , GLY C:212 , LEU C:213 , GLU C:216 , SER C:304 , ALA C:305 , VAL C:308 , THR C:309 , PHE C:483 , HEM C:601 , GOL C:606	binding site for residue SI6 C 602
17	AD8	SOFTWARE	GLU A:287 , HIS C:258 , ASP C:270 , GLU C:273	binding site for residue ZN C 603
18	AD9	SOFTWARE	GLN C:341 , HIS C:463	binding site for residue ZN C 604
19	AE1	SOFTWARE	HIS C:324 , HIS C:477 , HOH C:773	binding site for residue ZN C 605
20	AE2	SOFTWARE	LEU C:110 , LEU C:121 , ASP C:301 , SI6 C:602 , HOH C:772	binding site for residue GOL C 606
21	AE3	SOFTWARE	VAL C:119 , PHE C:120 , ASP C:301	binding site for residue NA C 607
22	AE4	SOFTWARE	ARG D:101 , VAL D:119 , PHE D:120 , TRP D:128 , ARG D:132 , ILE D:186 , LEU D:302 , THR D:309 , THR D:313 , VAL D:374 , HIS D:376 , LEU D:399 , PRO D:435 , PHE D:436 , SER D:437 , ARG D:441 , CYS D:443 , LEU D:444 , GLY D:445 , SI6 D:602 , HOH D:732	binding site for residue HEM D 601
23	AE5	SOFTWARE	PHE D:120 , ALA D:209 , GLY D:212 , LEU D:213 , GLU D:216 , ASP D:301 , SER D:304 , ALA D:305 , VAL D:308 , THR D:309 , PHE D:483 , HEM D:601 , GOL D:606	binding site for residue SI6 D 602
24	AE6	SOFTWARE	CYS D:191 , HIS D:258 , ASP D:270 , GLU D:273 , GLU D:287	binding site for residue ZN D 603
25	AE7	SOFTWARE	GLN D:341 , HIS D:463	binding site for residue ZN D 604
26	AE8	SOFTWARE	HIS D:324 , HIS D:477 , HOH D:717	binding site for residue ZN D 605
27	AE9	SOFTWARE	LEU D:110 , GLN D:244 , ALA D:300 , ASP D:301 , SER D:304 , SI6 D:602 , HOH D:781	binding site for residue GOL D 606
28	AF1	SOFTWARE	GLN D:131 , PHE D:134 , SER D:135 , VAL D:298 , HOH D:748	binding site for residue NA D 607

(no "SS Bond" information available for 4XRZ)

(no "Cis Peptide Bond" information available for 4XRZ)

(no "SAP(SNP)/Variant" information available for 4XRZ)

(no "PROSITE Motif" information available for 4XRZ)

(no "Exon" information available for 4XRZ)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:457
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhh.eeeeee..eeeeeeehhhhhhhhhh...........hhhhhhhh.............hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhh.......ee....eee..eee....eeeeehhhhhh...........hhhhhh.......................hhhhhhhhhhhhhhhhhhheeee...........eee...eee.....eeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xrz A  31 GKLPPGPLPDFQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELCAVPR 497
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       
                                   39|                                                                                                                                                                                                                                                                                                                                                                                                                                                               
                                    50

Chain B from PDB  Type:PROTEIN  Length:458
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhhhhh.eeeeee..eeeeeeehhhhhhhhhh.hhhhh.....hhhhhhhh.............hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh.......ee....eee..eee....eeeeehhhhhh...........hhhhhh.......................hhhhhhhhhhhhhhhhhhheeee...........eee...eee.....eeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xrz B  31 GKLPPGPLPVDFQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELCAVPR 497
                                    49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489        
                                   39|                                                                                                                                                                                                                                                                                                                                                                                                                                                                
                                    49

Chain C from PDB  Type:PROTEIN  Length:455
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhh.eeeeee..eeeeeehhhhhhhhhhh.hhhhh.....hhhhhh...............hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhh.......ee....eee..eee....eeeehhhhhhh...........hhhhhh.......................hhhhhhhhhhhhhhhhhhheeee...........ee.....ee.....eeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xrz C  31 GKLPPGPLPQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELCAVPR 497
                                    52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492     
                                   39|                                                                                                                                                                                                                                                                                                                                                                                                                                                             
                                    52

Chain D from PDB  Type:PROTEIN  Length:455
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhh..eeee......eeeehhhhhhhhhhh...........hhhhhh...............hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh.......ee....eee..eee....eeeehhhhhhh...........hhhhhh.......................hhhhhhhhhhhhhhhhhhheeee...........ee.....ee.....eeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xrz D  31 GKLPPGPLPQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELCAVPR 497
                                    52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492     
                                   39|                                                                                                                                                                                                                                                                                                                                                                                                                                                             
                                    52

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 4XRZ)

(no "CATH Domain" information available for 4XRZ)

(no "Pfam Domain" information available for 4XRZ)

Asymmetric Unit(hide GO term definitions)

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SI6	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]
		AD7	[ RasMol ]	+environment [ RasMol ]
		AD8	[ RasMol ]	+environment [ RasMol ]
		AD9	[ RasMol ]	+environment [ RasMol ]
		AE1	[ RasMol ]	+environment [ RasMol ]
		AE2	[ RasMol ]	+environment [ RasMol ]
		AE3	[ RasMol ]	+environment [ RasMol ]
		AE4	[ RasMol ]	+environment [ RasMol ]
		AE5	[ RasMol ]	+environment [ RasMol ]
		AE6	[ RasMol ]	+environment [ RasMol ]
		AE7	[ RasMol ]	+environment [ RasMol ]
		AE8	[ RasMol ]	+environment [ RasMol ]
		AE9	[ RasMol ]	+environment [ RasMol ]
		AF1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4xrz)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	4xrz
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CP2D6_HUMAN \| P10635
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.14.14.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CP2D6_HUMAN \| P10635
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CP2D6_HUMAN \| P10635	:	2f9q 3qm4 3tbg 3tda 4wnt 4wnu 4wnv 4wnw 4xry 5tft 5tfu

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (5, 28)

Sites (28, 28)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (34, 34)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File