4X1B - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   HUMAN SERUM TRANSFERRIN WITH FERRIC ION BOUND AT THE C-LOBE ONLY

Authors :   M. Wang, H. Zhang, H. Sun

Date :   24 Nov 14 (Deposition) - 08 Apr 15 (Release) - 06 May 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.45

Chains :   Asym./Biol. Unit : A

Keywords :   Transferrin, Ytterbium, Ferric, Malonate, Metal Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Wang, T. P. Lai, L. Wang, H. Zhang, N. Yang, P. J. Sadler, H. Sun
"Anion Clamp" Allows Flexible Protein To Impose Coordinatio Geometry On Metal Ions
Chem. Commun. (Camb. ) V. 51 7867 2015
PubMed-ID: 25854324 | Reference-DOI: 10.1039/C4CC09642H

Molecule 1 - SEROTRANSFERRIN
	Chains	:	A
	Organ	:	SERUM
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	FE-HTF,TRANSFERRIN,BETA-1 METAL-BINDING GLOBULIN, SIDEROPHILIN

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 3)

No.	Name	Count	Type	Full Name
1	FE	1	Ligand/Ion	FE (III) ION
2	GOL	1	Ligand/Ion	GLYCEROL
3	MLI	1	Ligand/Ion	MALONATE ION

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:392 , TYR A:426 , TYR A:517 , HIS A:585 , MLI A:702	binding site for residue FE A 701
2	AC2	SOFTWARE	ASP A:392 , TYR A:426 , THR A:452 , ARG A:456 , ALA A:458 , GLY A:459 , TYR A:517 , HIS A:585 , FE A:701 , HOH A:893	binding site for residue MLI A 702
3	AC3	SOFTWARE	CYS A:227 , LEU A:228 , ASP A:229 , HIS A:242 , LYS A:591 , HOH A:937 , HOH A:970	binding site for residue GOL A 703

Asymmetric/Biological Unit

No.	Residues
1	A:9	-	A:48
2	A:19	-	A:39
3	A:118	-	A:194
4	A:137	-	A:331
5	A:158	-	A:174
6	A:161	-	A:179
7	A:171	-	A:177
8	A:227	-	A:241
9	A:339	-	A:596
10	A:345	-	A:377
11	A:355	-	A:368
12	A:402	-	A:674
13	A:450	-	A:523
14	A:474	-	A:665
15	A:484	-	A:498
16	A:495	-	A:506
17	A:563	-	A:577

Asymmetric/Biological Unit

No.	Residues
1	Ala A:73	-	Pro A:74
2	Glu A:141	-	Pro A:142
3	Lys A:144	-	Pro A:145
4	Gly A:258	-	Lys A:259

(no "SAP(SNP)/Variant" information available for 4X1B)

(no "PROSITE Motif" information available for 4X1B)

(no "Exon" information available for 4X1B)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:650
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee.hhhhhhhhhhhhhhhhhhh.....eeeeee..hhhhhhhhhhh.....eeehhhhhhhhhh....eeeeeeee.........eeeeeeeee.....hhhhh...eeee........hhhhhhhhhhhh.....hhhhhhhh...eee........hhhhhh.............hhhhhhhhhhhh....eeeee.hhhhhhh.hhhhhh.eeee.....eee.hhhhhh..eeee..eeeee....hhhhhhhhhhhhhhhhh.........................eeee.....hhhhhhhhhhhhhhhhhhhh.......eeeee.hhhhhhhhhhhhhhhh..eeeee..hhhhhhhhhhh.....eeehhhhhhhhhhh..eeeeeee.....eeeeeee..............eeee........hhhhhhhhhhhhh..hhhhh..eee.......hhhhh....hhhhh.........hhhhhhhhhhhhh..eeeee.hhhhhh......hhhhhh.hhh.eeee.....eee.hhhhhh..ee....eeeehhhhhhhhhhhhhhhhhhhh...............eeee.....hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4x1b A   3 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPECKPVKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP 679
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332||     347       357       367       377       387       397       407     ||427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607   ||  629       639       649       659       669       679
                                                                                                                                                                                                                                                                                                                                                                    333|                                                                       413|                                                                                                                                                                                        611|                                                       
                                                                                                                                                                                                                                                                                                                                                                     339                                                                        424                                                                                                                                                                                         624

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 4X1B)

(no "CATH Domain" information available for 4X1B)

(no "Pfam Domain" information available for 4X1B)

Asymmetric/Biological Unit(hide GO term definitions)

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MLI	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:73 - Pro A:74	[ RasMol ]
		Glu A:141 - Pro A:142	[ RasMol ]
		Gly A:258 - Lys A:259	[ RasMol ]
		Lys A:144 - Pro A:145	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	4x1b
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TRFE_HUMAN \| P02787
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	TRFE_HUMAN \| P02787
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

4x1d	YTTERBIUM-BOUND HUMAN SERUM TRANSFERRIN

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 3)

Sites (3, 3)

SS Bonds (17, 17)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (36, 36)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File