2O7U - JenaLib

Asymmetric Unit (8, 72)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_034569	R	42	L	TRFE_HUMAN	Polymorphism	41298293	A/B/C/D/E/F/G/H/I	R	23	L
2	UniProt	VAR_029280	S	55	R	TRFE_HUMAN	Polymorphism	8177318	A/B/C/D/E/F/G/H/I	S	36	R
3	UniProt	VAR_034570	A	76	V	TRFE_HUMAN	Polymorphism	41298977	A/B/C/D/E/F/G/H/I	A	57	V
4	UniProt	VAR_038810	D	77	N	TRFE_HUMAN	Disease (ATRAF)	121918681	A/B/C/D/E/F/G/H/I	D	58	N
5	UniProt	VAR_011997	G	142	S	TRFE_HUMAN	Polymorphism	1799830	A/B/C/D/E/F/G/H/I	G	123	S
6	UniProt	VAR_011998	G	277	S	TRFE_HUMAN	Polymorphism	1799899	A/B/C/D/E/F/G/H/I	G	258	S
7	UniProt	VAR_007544	D	296	G	TRFE_HUMAN	Polymorphism	8177238	A/B/C/D/E/F/G/H/I	D	277	G
8	UniProt	VAR_007545	H	319	R	TRFE_HUMAN	Polymorphism	41295774	A/B/C/D/E/F/G/H/I	H	300	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (8, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_034569	R	42	L	TRFE_HUMAN	Polymorphism	41298293	B	R	23	L
2	UniProt	VAR_029280	S	55	R	TRFE_HUMAN	Polymorphism	8177318	B	S	36	R
3	UniProt	VAR_034570	A	76	V	TRFE_HUMAN	Polymorphism	41298977	B	A	57	V
4	UniProt	VAR_038810	D	77	N	TRFE_HUMAN	Disease (ATRAF)	121918681	B	D	58	N
5	UniProt	VAR_011997	G	142	S	TRFE_HUMAN	Polymorphism	1799830	B	G	123	S
6	UniProt	VAR_011998	G	277	S	TRFE_HUMAN	Polymorphism	1799899	B	G	258	S
7	UniProt	VAR_007544	D	296	G	TRFE_HUMAN	Polymorphism	8177238	B	D	277	G
8	UniProt	VAR_007545	H	319	R	TRFE_HUMAN	Polymorphism	41295774	B	H	300	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (8, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_034569	R	42	L	TRFE_HUMAN	Polymorphism	41298293	A	R	23	L
2	UniProt	VAR_029280	S	55	R	TRFE_HUMAN	Polymorphism	8177318	A	S	36	R
3	UniProt	VAR_034570	A	76	V	TRFE_HUMAN	Polymorphism	41298977	A	A	57	V
4	UniProt	VAR_038810	D	77	N	TRFE_HUMAN	Disease (ATRAF)	121918681	A	D	58	N
5	UniProt	VAR_011997	G	142	S	TRFE_HUMAN	Polymorphism	1799830	A	G	123	S
6	UniProt	VAR_011998	G	277	S	TRFE_HUMAN	Polymorphism	1799899	A	G	258	S
7	UniProt	VAR_007544	D	296	G	TRFE_HUMAN	Polymorphism	8177238	A	D	277	G
8	UniProt	VAR_007545	H	319	R	TRFE_HUMAN	Polymorphism	41295774	A	H	300	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (8, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_034569	R	42	L	TRFE_HUMAN	Polymorphism	41298293	C	R	23	L
2	UniProt	VAR_029280	S	55	R	TRFE_HUMAN	Polymorphism	8177318	C	S	36	R
3	UniProt	VAR_034570	A	76	V	TRFE_HUMAN	Polymorphism	41298977	C	A	57	V
4	UniProt	VAR_038810	D	77	N	TRFE_HUMAN	Disease (ATRAF)	121918681	C	D	58	N
5	UniProt	VAR_011997	G	142	S	TRFE_HUMAN	Polymorphism	1799830	C	G	123	S
6	UniProt	VAR_011998	G	277	S	TRFE_HUMAN	Polymorphism	1799899	C	G	258	S
7	UniProt	VAR_007544	D	296	G	TRFE_HUMAN	Polymorphism	8177238	C	D	277	G
8	UniProt	VAR_007545	H	319	R	TRFE_HUMAN	Polymorphism	41295774	C	H	300	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (8, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_034569	R	42	L	TRFE_HUMAN	Polymorphism	41298293	D	R	23	L
2	UniProt	VAR_029280	S	55	R	TRFE_HUMAN	Polymorphism	8177318	D	S	36	R
3	UniProt	VAR_034570	A	76	V	TRFE_HUMAN	Polymorphism	41298977	D	A	57	V
4	UniProt	VAR_038810	D	77	N	TRFE_HUMAN	Disease (ATRAF)	121918681	D	D	58	N
5	UniProt	VAR_011997	G	142	S	TRFE_HUMAN	Polymorphism	1799830	D	G	123	S
6	UniProt	VAR_011998	G	277	S	TRFE_HUMAN	Polymorphism	1799899	D	G	258	S
7	UniProt	VAR_007544	D	296	G	TRFE_HUMAN	Polymorphism	8177238	D	D	277	G
8	UniProt	VAR_007545	H	319	R	TRFE_HUMAN	Polymorphism	41295774	D	H	300	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (8, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_034569	R	42	L	TRFE_HUMAN	Polymorphism	41298293	E	R	23	L
2	UniProt	VAR_029280	S	55	R	TRFE_HUMAN	Polymorphism	8177318	E	S	36	R
3	UniProt	VAR_034570	A	76	V	TRFE_HUMAN	Polymorphism	41298977	E	A	57	V
4	UniProt	VAR_038810	D	77	N	TRFE_HUMAN	Disease (ATRAF)	121918681	E	D	58	N
5	UniProt	VAR_011997	G	142	S	TRFE_HUMAN	Polymorphism	1799830	E	G	123	S
6	UniProt	VAR_011998	G	277	S	TRFE_HUMAN	Polymorphism	1799899	E	G	258	S
7	UniProt	VAR_007544	D	296	G	TRFE_HUMAN	Polymorphism	8177238	E	D	277	G
8	UniProt	VAR_007545	H	319	R	TRFE_HUMAN	Polymorphism	41295774	E	H	300	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 6 (8, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_034569	R	42	L	TRFE_HUMAN	Polymorphism	41298293	F	R	23	L
2	UniProt	VAR_029280	S	55	R	TRFE_HUMAN	Polymorphism	8177318	F	S	36	R
3	UniProt	VAR_034570	A	76	V	TRFE_HUMAN	Polymorphism	41298977	F	A	57	V
4	UniProt	VAR_038810	D	77	N	TRFE_HUMAN	Disease (ATRAF)	121918681	F	D	58	N
5	UniProt	VAR_011997	G	142	S	TRFE_HUMAN	Polymorphism	1799830	F	G	123	S
6	UniProt	VAR_011998	G	277	S	TRFE_HUMAN	Polymorphism	1799899	F	G	258	S
7	UniProt	VAR_007544	D	296	G	TRFE_HUMAN	Polymorphism	8177238	F	D	277	G
8	UniProt	VAR_007545	H	319	R	TRFE_HUMAN	Polymorphism	41295774	F	H	300	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 7 (8, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_034569	R	42	L	TRFE_HUMAN	Polymorphism	41298293	G	R	23	L
2	UniProt	VAR_029280	S	55	R	TRFE_HUMAN	Polymorphism	8177318	G	S	36	R
3	UniProt	VAR_034570	A	76	V	TRFE_HUMAN	Polymorphism	41298977	G	A	57	V
4	UniProt	VAR_038810	D	77	N	TRFE_HUMAN	Disease (ATRAF)	121918681	G	D	58	N
5	UniProt	VAR_011997	G	142	S	TRFE_HUMAN	Polymorphism	1799830	G	G	123	S
6	UniProt	VAR_011998	G	277	S	TRFE_HUMAN	Polymorphism	1799899	G	G	258	S
7	UniProt	VAR_007544	D	296	G	TRFE_HUMAN	Polymorphism	8177238	G	D	277	G
8	UniProt	VAR_007545	H	319	R	TRFE_HUMAN	Polymorphism	41295774	G	H	300	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 8 (8, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_034569	R	42	L	TRFE_HUMAN	Polymorphism	41298293	H	R	23	L
2	UniProt	VAR_029280	S	55	R	TRFE_HUMAN	Polymorphism	8177318	H	S	36	R
3	UniProt	VAR_034570	A	76	V	TRFE_HUMAN	Polymorphism	41298977	H	A	57	V
4	UniProt	VAR_038810	D	77	N	TRFE_HUMAN	Disease (ATRAF)	121918681	H	D	58	N
5	UniProt	VAR_011997	G	142	S	TRFE_HUMAN	Polymorphism	1799830	H	G	123	S
6	UniProt	VAR_011998	G	277	S	TRFE_HUMAN	Polymorphism	1799899	H	G	258	S
7	UniProt	VAR_007544	D	296	G	TRFE_HUMAN	Polymorphism	8177238	H	D	277	G
8	UniProt	VAR_007545	H	319	R	TRFE_HUMAN	Polymorphism	41295774	H	H	300	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 9 (8, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_034569	R	42	L	TRFE_HUMAN	Polymorphism	41298293	I	R	23	L
2	UniProt	VAR_029280	S	55	R	TRFE_HUMAN	Polymorphism	8177318	I	S	36	R
3	UniProt	VAR_034570	A	76	V	TRFE_HUMAN	Polymorphism	41298977	I	A	57	V
4	UniProt	VAR_038810	D	77	N	TRFE_HUMAN	Disease (ATRAF)	121918681	I	D	58	N
5	UniProt	VAR_011997	G	142	S	TRFE_HUMAN	Polymorphism	1799830	I	G	123	S
6	UniProt	VAR_011998	G	277	S	TRFE_HUMAN	Polymorphism	1799899	I	G	258	S
7	UniProt	VAR_007544	D	296	G	TRFE_HUMAN	Polymorphism	8177238	I	D	277	G
8	UniProt	VAR_007545	H	319	R	TRFE_HUMAN	Polymorphism	41295774	I	H	300	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (4, 36)

Asymmetric Unit (4, 36)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRANSFERRIN_LIKE_4	PS51408	Transferrin-like domain profile.	TRFE_HUMAN	25-347 361-683	9	A:6-328 B:6-328 C:6-328 D:6-328 E:6-328 F:6-328 G:6-328 H:6-328 I:6-328 -
2	TRANSFERRIN_LIKE_1	PS00205	Transferrin-like domain signature 1.	TRFE_HUMAN	114-123	9	A:95-104 B:95-104 C:95-104 D:95-104 E:95-104 F:95-104 G:95-104 H:95-104 I:95-104
3	TRANSFERRIN_LIKE_2	PS00206	Transferrin-like domain signature 2.	TRFE_HUMAN	207-223 536-551	9	A:188-204 B:188-204 C:188-204 D:188-204 E:188-204 F:188-204 G:188-204 H:188-204 I:188-204 -
4	TRANSFERRIN_LIKE_3	PS00207	Transferrin-like domain signature 3.	TRFE_HUMAN	241-271 577-607	9	A:222-252 B:222-252 C:222-252 D:222-252 E:222-252 F:222-252 G:222-252 H:222-252 I:222-252 -

Biological Unit 1 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRANSFERRIN_LIKE_4	PS51408	Transferrin-like domain profile.	TRFE_HUMAN	25-347 361-683	1	- B:6-328 - - - - - - - -
2	TRANSFERRIN_LIKE_1	PS00205	Transferrin-like domain signature 1.	TRFE_HUMAN	114-123	1	- B:95-104 - - - - - - -
3	TRANSFERRIN_LIKE_2	PS00206	Transferrin-like domain signature 2.	TRFE_HUMAN	207-223 536-551	1	- B:188-204 - - - - - - - -
4	TRANSFERRIN_LIKE_3	PS00207	Transferrin-like domain signature 3.	TRFE_HUMAN	241-271 577-607	1	- B:222-252 - - - - - - - -

Biological Unit 2 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRANSFERRIN_LIKE_4	PS51408	Transferrin-like domain profile.	TRFE_HUMAN	25-347 361-683	1	A:6-328 - - - - - - - - -
2	TRANSFERRIN_LIKE_1	PS00205	Transferrin-like domain signature 1.	TRFE_HUMAN	114-123	1	A:95-104 - - - - - - - -
3	TRANSFERRIN_LIKE_2	PS00206	Transferrin-like domain signature 2.	TRFE_HUMAN	207-223 536-551	1	A:188-204 - - - - - - - - -
4	TRANSFERRIN_LIKE_3	PS00207	Transferrin-like domain signature 3.	TRFE_HUMAN	241-271 577-607	1	A:222-252 - - - - - - - - -

Biological Unit 3 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRANSFERRIN_LIKE_4	PS51408	Transferrin-like domain profile.	TRFE_HUMAN	25-347 361-683	1	- - C:6-328 - - - - - - -
2	TRANSFERRIN_LIKE_1	PS00205	Transferrin-like domain signature 1.	TRFE_HUMAN	114-123	1	- - C:95-104 - - - - - -
3	TRANSFERRIN_LIKE_2	PS00206	Transferrin-like domain signature 2.	TRFE_HUMAN	207-223 536-551	1	- - C:188-204 - - - - - - -
4	TRANSFERRIN_LIKE_3	PS00207	Transferrin-like domain signature 3.	TRFE_HUMAN	241-271 577-607	1	- - C:222-252 - - - - - - -

Biological Unit 4 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRANSFERRIN_LIKE_4	PS51408	Transferrin-like domain profile.	TRFE_HUMAN	25-347 361-683	1	- - - D:6-328 - - - - - -
2	TRANSFERRIN_LIKE_1	PS00205	Transferrin-like domain signature 1.	TRFE_HUMAN	114-123	1	- - - D:95-104 - - - - -
3	TRANSFERRIN_LIKE_2	PS00206	Transferrin-like domain signature 2.	TRFE_HUMAN	207-223 536-551	1	- - - D:188-204 - - - - - -
4	TRANSFERRIN_LIKE_3	PS00207	Transferrin-like domain signature 3.	TRFE_HUMAN	241-271 577-607	1	- - - D:222-252 - - - - - -

Biological Unit 5 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRANSFERRIN_LIKE_4	PS51408	Transferrin-like domain profile.	TRFE_HUMAN	25-347 361-683	1	- - - - E:6-328 - - - - -
2	TRANSFERRIN_LIKE_1	PS00205	Transferrin-like domain signature 1.	TRFE_HUMAN	114-123	1	- - - - E:95-104 - - - -
3	TRANSFERRIN_LIKE_2	PS00206	Transferrin-like domain signature 2.	TRFE_HUMAN	207-223 536-551	1	- - - - E:188-204 - - - - -
4	TRANSFERRIN_LIKE_3	PS00207	Transferrin-like domain signature 3.	TRFE_HUMAN	241-271 577-607	1	- - - - E:222-252 - - - - -

Biological Unit 6 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRANSFERRIN_LIKE_4	PS51408	Transferrin-like domain profile.	TRFE_HUMAN	25-347 361-683	1	- - - - - F:6-328 - - - -
2	TRANSFERRIN_LIKE_1	PS00205	Transferrin-like domain signature 1.	TRFE_HUMAN	114-123	1	- - - - - F:95-104 - - -
3	TRANSFERRIN_LIKE_2	PS00206	Transferrin-like domain signature 2.	TRFE_HUMAN	207-223 536-551	1	- - - - - F:188-204 - - - -
4	TRANSFERRIN_LIKE_3	PS00207	Transferrin-like domain signature 3.	TRFE_HUMAN	241-271 577-607	1	- - - - - F:222-252 - - - -

Biological Unit 7 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRANSFERRIN_LIKE_4	PS51408	Transferrin-like domain profile.	TRFE_HUMAN	25-347 361-683	1	- - - - - - G:6-328 - - -
2	TRANSFERRIN_LIKE_1	PS00205	Transferrin-like domain signature 1.	TRFE_HUMAN	114-123	1	- - - - - - G:95-104 - -
3	TRANSFERRIN_LIKE_2	PS00206	Transferrin-like domain signature 2.	TRFE_HUMAN	207-223 536-551	1	- - - - - - G:188-204 - - -
4	TRANSFERRIN_LIKE_3	PS00207	Transferrin-like domain signature 3.	TRFE_HUMAN	241-271 577-607	1	- - - - - - G:222-252 - - -

Biological Unit 8 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRANSFERRIN_LIKE_4	PS51408	Transferrin-like domain profile.	TRFE_HUMAN	25-347 361-683	1	- - - - - - - H:6-328 - -
2	TRANSFERRIN_LIKE_1	PS00205	Transferrin-like domain signature 1.	TRFE_HUMAN	114-123	1	- - - - - - - H:95-104 -
3	TRANSFERRIN_LIKE_2	PS00206	Transferrin-like domain signature 2.	TRFE_HUMAN	207-223 536-551	1	- - - - - - - H:188-204 - -
4	TRANSFERRIN_LIKE_3	PS00207	Transferrin-like domain signature 3.	TRFE_HUMAN	241-271 577-607	1	- - - - - - - H:222-252 - -

Biological Unit 9 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRANSFERRIN_LIKE_4	PS51408	Transferrin-like domain profile.	TRFE_HUMAN	25-347 361-683	1	- - - - - - - - I:6-328 -
2	TRANSFERRIN_LIKE_1	PS00205	Transferrin-like domain signature 1.	TRFE_HUMAN	114-123	1	- - - - - - - - I:95-104
3	TRANSFERRIN_LIKE_2	PS00206	Transferrin-like domain signature 2.	TRFE_HUMAN	207-223 536-551	1	- - - - - - - - I:188-204 -
4	TRANSFERRIN_LIKE_3	PS00207	Transferrin-like domain signature 3.	TRFE_HUMAN	241-271 577-607	1	- - - - - - - - I:222-252 -

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:329
 aligned with TRFE_HUMAN | P02787 from UniProtKB/Swiss-Prot  Length:698

    Alignment length:329
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341         
           TRFE_HUMAN    22 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 350
               SCOP domains d2o7ua_ A: automated matches                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 2o7uA01 A:3-84,A:250-331 Periplasmic binding protein-like II                      2o7uA02 A:85-249 Periplasmic binding protein-like II                                                                                                                 2o7uA01 A:3-84,A:250-331 Periplasmic binding protein-like II                       CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeehhhhhhhhhhhhhhhhhhh.....eeeeeee.hhhhhhhhhhh.....eeehhhhhhhhhh....eeeeeeeeee....ee.eeeeeeeee.....hhhhh....ee.........hhhhhhhhhhhh.....hhhhhhhhhh..ee........hhhhhh.hhhhh.......hhhhhhhhhhhh....eeeee.hhhhhhh.hhhhhh.eeeee...eeee.........eeee..eeeee....hhhhhhhhhhhhhhhh..........................eeee.....hhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------L------------R--------------------VN----------------------------------------------------------------S--------------------------------------------------------------------------------------------------------------------------------------S------------------G----------------------R------------------------------- SAPs(SNPs)
                PROSITE (1) ---TRANSFERRIN_LIKE_4  PDB: A:6-328 UniProt: 25-347                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------TRANSFERRI-----------------------------------------------------------------------------------TRANSFERRIN_LIKE_-----------------TRANSFERRIN_LIKE_3             ------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2o7u A   3 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFEDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 331
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322

Chain B from PDB  Type:PROTEIN  Length:329
 aligned with TRFE_HUMAN | P02787 from UniProtKB/Swiss-Prot  Length:698

    Alignment length:329
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341         
           TRFE_HUMAN    22 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 350
               SCOP domains d2o7ub_ B: automated matches                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 2o7uB01 B:3-84,B:250-331 Periplasmic binding protein-like II                      2o7uB02 B:85-249 Periplasmic binding protein-like II                                                                                                                 2o7uB01 B:3-84,B:250-331 Periplasmic binding protein-like II                       CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeehhhhhhhhhhhhhhhhhhh.....eeeeeee.hhhhhhhhhhh.....eeehhhhhhhhhh....eeeeeeeeee....ee.eeeeeeeee.....hhhhh....eee........hhhhhhhhhhhh.....hhhhhhhhhh..ee........hhhhhh.hhhhh.......hhhhhhhhhhhh....eeeee.hhhhhhh.hhhhhh.eeeee...eeee.........eeee..eeeee....hhhhhhhhhhhhhhhh..........................eeee.....hhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------L------------R--------------------VN----------------------------------------------------------------S--------------------------------------------------------------------------------------------------------------------------------------S------------------G----------------------R------------------------------- SAPs(SNPs)
                PROSITE (1) ---TRANSFERRIN_LIKE_4  PDB: B:6-328 UniProt: 25-347                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------TRANSFERRI-----------------------------------------------------------------------------------TRANSFERRIN_LIKE_-----------------TRANSFERRIN_LIKE_3             ------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2o7u B   3 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFEDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 331
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322

Chain C from PDB  Type:PROTEIN  Length:329
 aligned with TRFE_HUMAN | P02787 from UniProtKB/Swiss-Prot  Length:698

    Alignment length:329
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341         
           TRFE_HUMAN    22 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 350
               SCOP domains d2o7uc_ C: automated matches                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 2o7uC01 C:3-84,C:250-331 Periplasmic binding protein-like II                      2o7uC02 C:85-249 Periplasmic binding protein-like II                                                                                                                 2o7uC01 C:3-84,C:250-331 Periplasmic binding protein-like II                       CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeehhhhhhhhhhhhhhhhhhh.....eeeeeee.hhhhhhhhhhh.....eeehhhhhhhhhh....eeeeeeeeee....ee.eeeeeeeee.....hhhhh....eee........hhhhhhhhhhhh.....hhhhhhhhhh..ee........hhhhhh.hhhhh.......hhhhhhhhhhhh....eeeee.hhhhhhh.hhhhhh.eeeee...eeee.........eeee..eeeee....hhhhhhhhhhhhhhhh..........................eeee.....hhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------L------------R--------------------VN----------------------------------------------------------------S--------------------------------------------------------------------------------------------------------------------------------------S------------------G----------------------R------------------------------- SAPs(SNPs)
                PROSITE (1) ---TRANSFERRIN_LIKE_4  PDB: C:6-328 UniProt: 25-347                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------TRANSFERRI-----------------------------------------------------------------------------------TRANSFERRIN_LIKE_-----------------TRANSFERRIN_LIKE_3             ------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2o7u C   3 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFEDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 331
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322

Chain D from PDB  Type:PROTEIN  Length:329
 aligned with TRFE_HUMAN | P02787 from UniProtKB/Swiss-Prot  Length:698

    Alignment length:329
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341         
           TRFE_HUMAN    22 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 350
               SCOP domains d2o7ud_ D: automated matches                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 2o7uD01 D:3-84,D:250-331 Periplasmic binding protein-like II                      2o7uD02 D:85-249 Periplasmic binding protein-like II                                                                                                                 2o7uD01 D:3-84,D:250-331 Periplasmic binding protein-like II                       CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeehhhhhhhhhhhhhhhhhhh.....eeeeeee.hhhhhhhhhhh.....eeehhhhhhhhhh....eeeeeeeeee....ee.eeeeeeeee.....hhhhh....eee........hhhhhhhhhhhh.....hhhhhhhhhh..ee........hhhhhh.............hhhhhhhhhhhh....eeeee.hhhhhh..hhhhhh.eeee.....eee.hhhhhh..eeee..eeeee....hhhhhhhhhhhhhhhhh.........................eeee.....hhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------L------------R--------------------VN----------------------------------------------------------------S--------------------------------------------------------------------------------------------------------------------------------------S------------------G----------------------R------------------------------- SAPs(SNPs)
                PROSITE (1) ---TRANSFERRIN_LIKE_4  PDB: D:6-328 UniProt: 25-347                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------TRANSFERRI-----------------------------------------------------------------------------------TRANSFERRIN_LIKE_-----------------TRANSFERRIN_LIKE_3             ------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2o7u D   3 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFEDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 331
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322

Chain E from PDB  Type:PROTEIN  Length:329
 aligned with TRFE_HUMAN | P02787 from UniProtKB/Swiss-Prot  Length:698

    Alignment length:329
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341         
           TRFE_HUMAN    22 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 350
               SCOP domains d2o7ue_ E: automated matches                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 2o7uE01 E:3-84,E:250-331 Periplasmic binding protein-like II                      2o7uE02 E:85-249 Periplasmic binding protein-like II                                                                                                                 2o7uE01 E:3-84,E:250-331 Periplasmic binding protein-like II                       CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeehhhhhhhhhhhhhhhhhhh.....eeeeeee.hhhhhhhhhhh.....eeehhhhhhhhhh....eeeeeeeeee....ee.eeeeeeeee.....hhhhh....eee........hhhhhhhhhhhh.....hhhhhhhhhh..ee........hhhhhh.............hhhhhhhhhhhh....eeeee.hhhhhh..hhhhhh.eeee.....eee.hhhhhh..eeee..eeeee....hhhhhhhhhhhhhhhhh.........................eeee.....hhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------L------------R--------------------VN----------------------------------------------------------------S--------------------------------------------------------------------------------------------------------------------------------------S------------------G----------------------R------------------------------- SAPs(SNPs)
                PROSITE (1) ---TRANSFERRIN_LIKE_4  PDB: E:6-328 UniProt: 25-347                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------TRANSFERRI-----------------------------------------------------------------------------------TRANSFERRIN_LIKE_-----------------TRANSFERRIN_LIKE_3             ------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2o7u E   3 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFEDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 331
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322

Chain F from PDB  Type:PROTEIN  Length:329
 aligned with TRFE_HUMAN | P02787 from UniProtKB/Swiss-Prot  Length:698

    Alignment length:329
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341         
           TRFE_HUMAN    22 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 350
               SCOP domains d2o7uf_ F: automated matches                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 2o7uF01 F:3-84,F:250-331 Periplasmic binding protein-like II                      2o7uF02 F:85-249 Periplasmic binding protein-like II                                                                                                                 2o7uF01 F:3-84,F:250-331 Periplasmic binding protein-like II                       CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeehhhhhhhhhhhhhhhhhhh.....eeeeeee.hhhhhhhhhhh.....eeehhhhhhhhhh....eeeeeeeeee....ee.eeeeeeeee.....hhhhh....eee........hhhhhhhhhhhh.....hhhhhhhhhh..ee........hhhhhh.............hhhhhhhhhhhh....eeeee.hhhhhh..hhhhhh.eeee.....eee.hhhhhh..eeee..eeeee....hhhhhhhhhhhhhhhhh.........................eeee.....hhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------L------------R--------------------VN----------------------------------------------------------------S--------------------------------------------------------------------------------------------------------------------------------------S------------------G----------------------R------------------------------- SAPs(SNPs)
                PROSITE (1) ---TRANSFERRIN_LIKE_4  PDB: F:6-328 UniProt: 25-347                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------TRANSFERRI-----------------------------------------------------------------------------------TRANSFERRIN_LIKE_-----------------TRANSFERRIN_LIKE_3             ------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2o7u F   3 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFEDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 331
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322

Chain G from PDB  Type:PROTEIN  Length:329
 aligned with TRFE_HUMAN | P02787 from UniProtKB/Swiss-Prot  Length:698

    Alignment length:329
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341         
           TRFE_HUMAN    22 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 350
               SCOP domains d2o7ug_ G: automated matches                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 2o7uG01 G:3-84,G:250-331 Periplasmic binding protein-like II                      2o7uG02 G:85-249 Periplasmic binding protein-like II                                                                                                                 2o7uG01 G:3-84,G:250-331 Periplasmic binding protein-like II                       CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeehhhhhhhhhhhhhhhhhhh.....eeeeeee.hhhhhhhhhhh.....eeehhhhhhhhhh....eeeeeeeeee....ee.eeeeeeeee.....hhhhh....eee........hhhhhhhhhhhh.....hhhhhhhhhh..ee........hhhhhh.............hhhhhhhhhhhh....eeeee.hhhhhh..hhhhhh.eeee.....eee.hhhhhh..eeee..eeeee....hhhhhhhhhhhhhhhhh.........................eeee.....hhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------L------------R--------------------VN----------------------------------------------------------------S--------------------------------------------------------------------------------------------------------------------------------------S------------------G----------------------R------------------------------- SAPs(SNPs)
                PROSITE (1) ---TRANSFERRIN_LIKE_4  PDB: G:6-328 UniProt: 25-347                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------TRANSFERRI-----------------------------------------------------------------------------------TRANSFERRIN_LIKE_-----------------TRANSFERRIN_LIKE_3             ------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2o7u G   3 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFEDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 331
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322

Chain H from PDB  Type:PROTEIN  Length:329
 aligned with TRFE_HUMAN | P02787 from UniProtKB/Swiss-Prot  Length:698

    Alignment length:329
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341         
           TRFE_HUMAN    22 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 350
               SCOP domains d2o7uh_ H: automated matches                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 2o7uH01 H:3-84,H:250-331 Periplasmic binding protein-like II                      2o7uH02 H:85-249 Periplasmic binding protein-like II                                                                                                                 2o7uH01 H:3-84,H:250-331 Periplasmic binding protein-like II                       CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeehhhhhhhhhhhhhhhhhhh.....eeeeeee.hhhhhhhhhhh.....eeehhhhhhhhhh....eeeeeeeeee....ee.eeeeeeeee.....hhhhh....eee........hhhhhhhhhhhh.....hhhhhhhhhh..ee........hhhhhh.............hhhhhhhhhhhh....eeeee.hhhhhh..hhhhhh.eeee.....eee.hhhhhh..eeee..eeeee....hhhhhhhhhhhhhhhhh.........................eeee.....hhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------L------------R--------------------VN----------------------------------------------------------------S--------------------------------------------------------------------------------------------------------------------------------------S------------------G----------------------R------------------------------- SAPs(SNPs)
                PROSITE (1) ---TRANSFERRIN_LIKE_4  PDB: H:6-328 UniProt: 25-347                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------TRANSFERRI-----------------------------------------------------------------------------------TRANSFERRIN_LIKE_-----------------TRANSFERRIN_LIKE_3             ------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2o7u H   3 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFEDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 331
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322

Chain I from PDB  Type:PROTEIN  Length:329
 aligned with TRFE_HUMAN | P02787 from UniProtKB/Swiss-Prot  Length:698

    Alignment length:329
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341         
           TRFE_HUMAN    22 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 350
               SCOP domains d2o7ui_ I: automated matches                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 2o7uI01 I:3-84,I:250-331 Periplasmic binding protein-like II                      2o7uI02 I:85-249 Periplasmic binding protein-like II                                                                                                                 2o7uI01 I:3-84,I:250-331 Periplasmic binding protein-like II                       CATH domains
           Pfam domains (1) ---Transferrin-2o7uI01 I:6-328                                                                                                                                                                                                                                                                                                        --- Pfam domains (1)
           Pfam domains (2) ---Transferrin-2o7uI02 I:6-328                                                                                                                                                                                                                                                                                                        --- Pfam domains (2)
           Pfam domains (3) ---Transferrin-2o7uI03 I:6-328                                                                                                                                                                                                                                                                                                        --- Pfam domains (3)
           Pfam domains (4) ---Transferrin-2o7uI04 I:6-328                                                                                                                                                                                                                                                                                                        --- Pfam domains (4)
           Pfam domains (5) ---Transferrin-2o7uI05 I:6-328                                                                                                                                                                                                                                                                                                        --- Pfam domains (5)
           Pfam domains (6) ---Transferrin-2o7uI06 I:6-328                                                                                                                                                                                                                                                                                                        --- Pfam domains (6)
           Pfam domains (7) ---Transferrin-2o7uI07 I:6-328                                                                                                                                                                                                                                                                                                        --- Pfam domains (7)
           Pfam domains (8) ---Transferrin-2o7uI08 I:6-328                                                                                                                                                                                                                                                                                                        --- Pfam domains (8)
           Pfam domains (9) ---Transferrin-2o7uI09 I:6-328                                                                                                                                                                                                                                                                                                        --- Pfam domains (9)
         Sec.struct. author ..eeeeeeehhhhhhhhhhhhhhhhhhh.....eeeeeee.hhhhhhhhhhh.....eeehhhhhhhhhh....eeeeeeeeeee..eee.eeeeeeeee.....hhhhh....eee........hhhhhhhhhhhh.....hhhhhhhhhh..ee........hhhhhh.............hhhhhhhhhhhh....eeeee.hhhhhh..hhhhhh.eeee.....eee.hhhhhh..eeee..eeeee....hhhhhhhhhhhhhhhhh.........................eeee.....hhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------L------------R--------------------VN----------------------------------------------------------------S--------------------------------------------------------------------------------------------------------------------------------------S------------------G----------------------R------------------------------- SAPs(SNPs)
                PROSITE (1) ---TRANSFERRIN_LIKE_4  PDB: I:6-328 UniProt: 25-347                                                                                                                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------TRANSFERRI-----------------------------------------------------------------------------------TRANSFERRIN_LIKE_-----------------TRANSFERRIN_LIKE_3             ------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2o7u I   3 DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFEDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC 331
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 9)

CATH Domains (1, 18)

Pfam Domains (1, 9)

Gene Ontology (36, 36)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F,G,H,I (TRFE_HUMAN | P02787)

molecular function
	GO:0008199	ferric iron binding	Interacting selectively and non-covalently with ferric iron, Fe(III).
	GO:0015091	ferric iron transmembrane transporter activity	Enables the transfer of ferric iron (Fe(III) or Fe3+) ions from one side of a membrane to the other.
	GO:0008198	ferrous iron binding	Interacting selectively and non-covalently with ferrous iron, Fe(II).
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:1990459	transferrin receptor binding	Interacting selectively and non-covalently with the transferrin receptor.
biological process
	GO:0006879	cellular iron ion homeostasis	Any process involved in the maintenance of an internal steady state of iron ions at the level of a cell.
	GO:0071281	cellular response to iron ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an iron ion stimulus.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0055072	iron ion homeostasis	Any process involved in the maintenance of an internal steady state of iron ions within an organism or cell.
	GO:0006826	iron ion transport	The directed movement of iron (Fe) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0002576	platelet degranulation	The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
	GO:0048260	positive regulation of receptor-mediated endocytosis	Any process that activates or increases the frequency, rate or extent of receptor mediated endocytosis, the uptake of external materials by cells, utilizing receptors to ensure specificity of transport.
	GO:0031647	regulation of protein stability	Any process that affects the structure and integrity of a protein, altering the likelihood of its degradation or aggregation.
	GO:0001895	retina homeostasis	A tissue homeostatic process involved in the maintenance of an internal equilibrium within the retina of the eye, including control of cellular proliferation and death and control of metabolic function.
	GO:0033572	transferrin transport	The directed movement of transferrin into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:1990712	HFE-transferrin receptor complex	A protein complex containing at least HFE and a transferrin receptor (either TFR1/TFRC or TFR2), proposed to play a role in the sensing of transferrin-bound Fe (Fe2-Tf) on the plasma membrane to regulate hepcidin transcription.
	GO:0016324	apical plasma membrane	The region of the plasma membrane located at the apical end of the cell.
	GO:0045178	basal part of cell	The region of a cell situated near the base. For example, in a polarized epithelial cell, the basal surface rests on the basal lamina that separates the epithelium from other tissue.
	GO:0009925	basal plasma membrane	The region of the plasma membrane located at the basal end of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0005905	clathrin-coated pit	A part of the endomembrane system in the form of an invagination of a membrane upon which a clathrin coat forms, and that can be converted by vesicle budding into a clathrin-coated vesicle. Coated pits form on the plasma membrane, where they are involved in receptor-mediated selective transport of many proteins and other macromolecules across the cell membrane, in the trans-Golgi network, and on some endosomes.
	GO:0005769	early endosome	A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
	GO:0030139	endocytic vesicle	A membrane-bounded intracellular vesicle formed by invagination of the plasma membrane around an extracellular substance. Endocytic vesicles fuse with early endosomes to deliver the cargo for further sorting.
	GO:0010008	endosome membrane	The lipid bilayer surrounding an endosome.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0031232	extrinsic component of external side of plasma membrane	The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its external surface, but not integrated into the hydrophobic region.
	GO:0005770	late endosome	A prelysosomal endocytic organelle differentiated from early endosomes by lower lumenal pH and different protein composition. Late endosomes are more spherical than early endosomes and are mostly juxtanuclear, being concentrated near the microtubule organizing center.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0055037	recycling endosome	An organelle consisting of a network of tubules that functions in targeting molecules, such as receptors transporters and lipids, to the plasma membrane.
	GO:0034774	secretory granule lumen	The volume enclosed by the membrane of a secretory granule.
	GO:0031982	vesicle	Any small, fluid-filled, spherical organelle enclosed by membrane.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 18)

Sites (18, 18)

SS Bonds (72, 72)

Cis Peptide Bonds (27, 27)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (8, 72)

PROSITE Motifs (4, 36)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 9)

CATH Domains (1, 18)

Pfam Domains (1, 9)

Gene Ontology (36, 36)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File