Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  HUMAN TANKYRASE 1 WITH SMALL MOLECULE INHIBITOR
 
Authors :  S. L. Kazmirski, J. Johannes, P. A. Boriack-Sjodin, T. Howard
Date :  20 Aug 14  (Deposition) - 13 May 15  (Release) - 13 May 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.95
Chains :  Asym./Biol. Unit :  A
Keywords :  Tankyrase Inhibitor Small Molecule (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. W. Johannes, L. Almeida, B. Barlaam, P. A. Boriack-Sjodin, R. Casella, R. A. Croft, A. P. Dishington, L. Gingipalli, C. Gu, J. L. Hawkins, J. L. Holmes, T. Howard, J. Huang, S. Ioannidis, S. Kazmirski, M. L. Lamb, T. M. Mcguire, J. E. Moore, D. Ogg, A. Patel, K. G. Pike, T. Pontz, G. R. Robb, N. Su, H. Wang, X. Wu, H. J. Zhang, Y. Zhang, X. Zheng, T. Wang
Pyrimidinone Nicotinamide Mimetics As Selective Tankyrase And Wnt Pathway Inhibitors Suitable For In Vivo Pharmacology.
Acs Med. Chem. Lett. V. 6 254 2015
PubMed-ID: 25815142  |  Reference-DOI: 10.1021/ML5003663

(-) Compounds

Molecule 1 - TANKYRASE-1
    Chains: A
    EC Number: 2.4.2.30
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: PARP DOMAIN
    Gene: TNKS, PARP5A, PARPL, TIN1, TINF1, TNKS1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: TANK1,ADP-RIBOSYLTRANSFERASE DIPHTHERIA TOXIN-LIKE 5,ARTD5, POLY [ADP-RIBOSE] POLYMERASE 5A,TNKS-1,TRF1-INTERACTING ANKYRIN- RELATED ADP-RIBOSE POLYMERASE,TANKYRASE I

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
13J51Ligand/Ion2-(4-{6-[(3S)-3,4-DIMETHYLPIPERAZIN-1-YL]-4-METHYLPYRIDIN-3-YL}PHENYL)-8-(HYDROXYMETHYL)QUINAZOLIN-4(3H)-ONE
2ZN1Ligand/IonZINC ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:1234 , HIS A:1237 , CYS A:1242 , CYS A:1245binding site for residue ZN A 1401
2AC2SOFTWAREHIS A:1184 , GLY A:1185 , PHE A:1188 , ALA A:1202 , TYR A:1203 , TYR A:1213 , PHE A:1214 , ALA A:1215 , LYS A:1220 , SER A:1221 , TYR A:1224 , GLU A:1291 , HOH A:1636 , HOH A:1638binding site for residue 3J5 A 1402

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4W6E)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4W6E)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4W6E)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4W6E)

(-) Exons   (0, 0)

(no "Exon" information available for 4W6E)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                   
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeee....hhhhhhhhhhhhhh................eeeeeeeeeehhhhhhhhhhhhhhhhhhh.....eeeeee...hhhhhhhhh.hhhhh.........eeee.hhhhhhh...hhhhh...............eeeeeeeee...eeee..............eeee.........eeee.hhh.eeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                4w6e A 1104 SMTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTIKMAHAPPGHHSVIGRPSVGLAYAEYVIYRGEQAYPEYLITYQIMKPE 1314
                                  1113      1123      1133      1143      1153      1163      1173      1183      1193      1203      1213      1223      1233      1243      1253      1263      1273      1283||    1294      1304      1314
                                                                                                                                                                                                             1284|                            
                                                                                                                                                                                                              1286
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4W6E)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4W6E)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4W6E)

(-) Gene Ontology  (46, 46)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    3J5  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4w6e)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4w6e
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TNKS1_HUMAN | O95271
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.4.2.30
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TNKS1_HUMAN | O95271
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TNKS1_HUMAN | O95271: 2rf5 3udd 3uh2 3uh4 4dvi 4i9i 4k4e 4k4f 4krs 4li6 4li7 4li8 4msg 4msk 4mt9 4n3r 4n4v 4oa7 4tor 4tos 4u6a 4uuh 4uw1 4w5s 5ebt 5ece 5ety 5gp7 5jhq 5jti 5ju5 5kni

(-) Related Entries Specified in the PDB File

4w5s