Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  KSHV LANA (ORF73) C-TERMINAL DOMAIN, SPIRAL: HEXAGONAL CRYSTAL FORM
 
Authors :  J. Hellert, J. Krausze, T. Luhrs
Date :  05 Sep 14  (Deposition) - 13 May 15  (Release) - 10 Jun 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.70
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A (12x),B (12x),C (12x),D (12x)
Keywords :  Viral Protein, Dna-Binding Domain, Origin-Binding Domain, Oligomerization Domain, Hhv-8, Gammaherpesvirus, Rhadinovirus, Primary Effusion Lymphoma, Multicentric Castleman'S Disease, Tumor Virus, Cancer (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Hellert, M. Weidner-Glunde, J. Krausze, H. Lunsdorf, C. Ritter, T. F. Schulz, T. Luhrs
The 3D Structure Of Kaposi Sarcoma Herpesvirus Lana C- Terminal Domain Bound To Dna.
Proc. Natl. Acad. Sci. Usa V. 112 6694 2015
PubMed-ID: 25947153  |  Reference-DOI: 10.1073/PNAS.1421804112

(-) Compounds

Molecule 1 - ORF 73
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-BASED
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Fragment: C-TERMINAL DOMAIN, RESIDUES 1013-1149
    Organism Scientific: HUMAN HERPESVIRUS 8
    Organism Taxid: 37296
    Synonym: LATENCY-ASSOCIATED NUCLEAR ANTIGEN, LANA-1, KSHV LANA

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (12x): A (12x)B (12x)C (12x)D (12x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 4UZC)

(-) Sites  (0, 0)

(no "Site" information available for 4UZC)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4UZC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4UZC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4UZC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4UZC)

(-) Exons   (0, 0)

(no "Exon" information available for 4UZC)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:134
                                                                                                                                                                       
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhh.....hhhhhhhhhhhhhhh.........eeeeeee..hhhhhhhhhh.....eee...ee............eeeeeee..hhhhhhhhhhhhhhhhh.......eeeeee......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4uzc A 1014 YQQPPVPYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTSKKVQMARLAWEASHPLAGNLQSSIVKFKKPLPLTQ 1147
                                  1023      1033      1043      1053      1063      1073      1083      1093      1103      1113      1123      1133      1143    


Chain B from PDB  Type:PROTEIN  Length:134
                                                                                                                                                                       
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhh.....hhhhhhhhhhhhhhh.........eeeeeee..hhhhhhhhhh.....eee...ee............eeeeeee..hhhhhhhhhhhhhhhhh.......eeeeeee........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4uzc B 1014 YQQPPVPYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTSKKVQMARLAWEASHPLAGNLQSSIVKFKKPLPLTQ 1147
                                  1023      1033      1043      1053      1063      1073      1083      1093      1103      1113      1123      1133      1143    


Chain C from PDB  Type:PROTEIN  Length:134
                                                                                                                                                                       
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhh.....hhhhhhhhhhhhhhh.........eeeeeee..hhhhhhhhhh.....eee...ee............eeeeeee..hhhhhhhhhhhhhhhhh.......eeeeeee........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4uzc C 1014 YQQPPVPYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTSKKVQMARLAWEASHPLAGNLQSSIVKFKKPLPLTQ 1147
                                  1023      1033      1043      1053      1063      1073      1083      1093      1103      1113      1123      1133      1143    


Chain D from PDB  Type:PROTEIN  Length:134
                                                                                                                                                                       
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhh.....hhhhhhhhhhhhhhh.........eeeeeee..hhhhhhhhhh.....eee...ee............eeeeeee..hhhhhhhhhhhhhhhhh.......eeeeee......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4uzc D 1014 YQQPPVPYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTSKKVQMARLAWEASHPLAGNLQSSIVKFKKPLPLTQ 1147
                                  1023      1033      1043      1053      1063      1073      1083      1093      1103      1113      1123      1133      1143
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4UZC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4UZC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4UZC)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 4UZC)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4uzc)
 
  Sites
(no "Sites" information available for 4uzc)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4uzc)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4uzc
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ORF73_HHV8P | Q9QR71
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  Q76SB0_HHV8 | Q76SB0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ORF73_HHV8P | Q9QR71
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q76SB0_HHV8 | Q76SB0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ORF73_HHV8P | Q9QR71: 4uzb
        Q76SB0_HHV8 | Q76SB0: 4uzb 5a76
UniProtKB/TrEMBL
        Q76SB0_HHV8 | Q76SB0: 2ypy 2ypz 2yq0

(-) Related Entries Specified in the PDB File

4uzb KSHV LANA (ORF73) C-TERMINAL DOMAIN MUTANT BOUND TO LBS1 DNA (R1039Q, R1040Q, K1055E, K1109A, D1110A, A1121E , K1138S, K1140D, K1141D)