Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  MECHANISTIC INSIGHTS FROM THE CRYSTAL STRUCTURE OF AN INWARD PROTON-TRANSPORTING ANABAENA SENSORY RHODOPSIN MUTANT
 
Authors :  B. H. Dong, H. Luecke
Date :  29 May 14  (Deposition) - 16 Jul 14  (Release) - 29 Oct 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Transmembrane, Photoreceptor, Proton Pump, Bacterial Rhodopsin, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. H. Dong, H. Luecke
Mechanistic Insights From The Crystal Structure Of An Inwar Proton-Transportinganabaena Sensory Rhodopsin Mutant
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - ANABAENA SENSORY RHODOPSIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: ALR3165
    Mutation: YES
    Organism Scientific: NOSTOC SP.
    Organism Taxid: 103690
    Strain: PCC 7120 / UTEX 2576

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 37)

Asymmetric/Biological Unit (2, 37)
No.NameCountTypeFull Name
1PEE35Ligand/Ion1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOETHANOLAMINE
2RET2Ligand/IonRETINAL

(-) Sites  (34, 34)

Asymmetric Unit (34, 34)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETRP A:76 , THR A:80 , LEU A:83 , VAL A:112 , TYR A:132 , PHE A:139 , TRP A:176 , TYR A:179 , LYS A:210binding site for residue RET A 301
02AC2SOFTWAREMET A:1 , TRP A:9 , THR A:16binding site for residue PEE A 303
03AC3SOFTWARELYS A:167 , PEE A:317binding site for residue PEE A 304
04AC4SOFTWAREPHE A:42binding site for residue PEE A 305
05AC5SOFTWARETYR A:70 , MET A:77 , TRP B:126binding site for residue PEE A 306
06AC6SOFTWAREPEE B:304binding site for residue PEE A 308
07AC7SOFTWARETRP A:46binding site for residue PEE A 309
08AC8SOFTWARETRP A:99 , THR A:100 , SER A:107binding site for residue PEE A 310
09AC9SOFTWARETRP A:23 , ARG A:27binding site for residue PEE A 311
10AD1SOFTWARETRP A:23 , ILE A:45 , GLY A:48binding site for residue PEE A 312
11AD2SOFTWARETRP A:147binding site for residue PEE A 313
12AD3SOFTWARETRP A:126binding site for residue PEE A 314
13AD4SOFTWAREGLY A:178 , PEE B:312binding site for residue PEE A 315
14AD5SOFTWAREPHE A:208 , PEE A:304binding site for residue PEE A 317
15AD6SOFTWAREPEE A:321 , TRP B:99 , THR B:100 , SER B:107 , PEE B:302binding site for residue PEE A 319
16AD7SOFTWARETRP A:144 , ASN A:148 , PRO A:149 , PEE A:319binding site for residue PEE A 321
17AD8SOFTWAREPEE A:319 , MET B:77 , TRP B:99 , PEE B:310binding site for residue PEE B 302
18AD9SOFTWAREPEE B:318binding site for residue PEE B 303
19AE1SOFTWAREILE A:17 , PHE A:207 , PHE A:215 , PEE A:308 , TRP B:192binding site for residue PEE B 304
20AE2SOFTWARETHR B:170binding site for residue PEE B 305
21AE3SOFTWARETRP B:147 , ARG B:151binding site for residue PEE B 306
22AE4SOFTWAREMET B:1 , TRP B:9 , THR B:16binding site for residue PEE B 307
23AE5SOFTWAREPHE B:42 , TRP B:46binding site for residue PEE B 308
24AE6SOFTWARELEU A:3 , THR A:196 , PHE A:200 , TRP B:23 , ARG B:27binding site for residue PEE B 309
25AE7SOFTWARETRP A:126 , TRP A:131 , TYR B:70 , PEE B:302binding site for residue PEE B 310
26AE8SOFTWAREVAL A:174 , PEE A:315 , MET B:1binding site for residue PEE B 312
27AE9SOFTWARETYR B:171binding site for residue PEE B 313
28AF1SOFTWAREILE B:141binding site for residue PEE B 315
29AF2SOFTWAREPHE B:94 , LEU B:224 , ASN B:225 , HOH B:628 , HOH B:643binding site for residue PEE B 317
30AF3SOFTWARETRP A:192 , ILE B:17 , PHE B:215 , HIS B:219 , PEE B:303binding site for residue PEE B 318
31AF4SOFTWARELEU B:205 , PEE B:320binding site for residue PEE B 319
32AF5SOFTWAREVAL B:174 , PEE B:319binding site for residue PEE B 320
33AF6SOFTWARETYR B:129 , ILE B:133binding site for residue PEE B 322
34AF7SOFTWARETYR B:11 , SER B:47 , ASP B:75 , TRP B:76 , THR B:79 , THR B:80 , VAL B:112 , PHE B:139 , TRP B:176 , TYR B:179 , TRP B:183 , PRO B:206 , PHE B:207 , PHE B:208 , SER B:209 , VAL B:211 , SER B:214 , HOH B:502binding site for residue RET B 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4TL3)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4TL3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4TL3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4TL3)

(-) Exons   (0, 0)

(no "Exon" information available for 4TL3)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:216
                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4tl3 A   1 MNLESLLHWIYVAGMTIGALHFWSLSRNPRGVPQYEYLVAMFIPIWSGLAYMAMAIIAHYARYIDWMVTTPLLLLSLSWTAMQFIKKDWTLIGFLMSTQIVVITSGLIADLSERDWVRYLWYICGVCAFLIILWGIWNPLRAKTRTQSSELANLYDKLVTYFTVLWIGYPIVWIIGPSGFGWINQTIDTFLFCLLPFFSKVGFSFLELHGLRNLND 226
                                    10        20        30        40        50     || 70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220      
                                                                                  56|                                                                                                                                                               
                                                                                   67                                                                                                                                                               


Chain B from PDB  Type:PROTEIN  Length:217
                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tl3 B   1 MNLESLLHWIYVAGMTIGALHFWSLSRNPRGVPQYEYLVAMFIPIWSGLAYMAMAIDIAHYARYIDWMVTTPLLLLSLSWTAMQFIKKDWTLIGFLMSTQIVVITSGLIADLSERDWVRYLWYICGVCAFLIILWGIWNPLRAKTRTQSSELANLYDKLVTYFTVLWIGYPIVWIIGPSGFGWINQTIDTFLFCLLPFFSKVGFSFLELHGLRNLND 226
                                    10        20        30        40        50      ||69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       
                                                                                   57|                                                                                                                                                               
                                                                                    67
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4TL3)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4TL3)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4TL3)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PEE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    RET  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4tl3)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4tl3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8YSC4_NOSS1 | Q8YSC4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8YSC4_NOSS1 | Q8YSC4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Q8YSC4_NOSS1 | Q8YSC4: 5uk6
UniProtKB/TrEMBL
        Q8YSC4_NOSS1 | Q8YSC4: 1xio 2m3g

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4TL3)