Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MONOGLYCERIDE LIPASE FROM BACILLUS SP. H257 IN COMPLEX WITH MONOPALMITOYL GLYCEROL ANALOGUE
 
Authors :  S. Rengachari, P. Aschauer, K. Gruber, I. Dreveny, M. Oberer
Date :  25 Apr 13  (Deposition) - 18 Sep 13  (Release) - 20 Nov 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.85
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Alpha/Beta Hydrolase, Monoglyceride Lipase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Rengachari, P. Aschauer, M. Schittmayer, N. Mayer, K. Gruber, R. Breinbauer, R. Birner-Gruenberger, I. Dreveny, M. Oberer
Conformational Plasticity And Ligand Binding Of Bacterial Monoacylglycerol Lipase.
J. Biol. Chem. V. 288 31093 2013
PubMed-ID: 24014019  |  Reference-DOI: 10.1074/JBC.M113.491415

(-) Compounds

Molecule 1 - THERMOSTABLE MONOACYLGLYCEROL LIPASE
    Chains: A, B, C, D
    EC Number: 3.1.1.23
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PET28A(+)
    Organism Scientific: BACILLUS SP.
    Organism Taxid: 129908
    Strain: H-257
    Synonym: MGLP

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A   
Biological Unit 2 (1x):  B  
Biological Unit 3 (1x):   C 
Biological Unit 4 (1x):    D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
11QY4Ligand/IonTETRADECYL HYDROGEN (R)-(3-AZIDOPROPYL)PHOSPHONATE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
11QY1Ligand/IonTETRADECYL HYDROGEN (R)-(3-AZIDOPROPYL)PHOSPHONATE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
11QY1Ligand/IonTETRADECYL HYDROGEN (R)-(3-AZIDOPROPYL)PHOSPHONATE
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
11QY1Ligand/IonTETRADECYL HYDROGEN (R)-(3-AZIDOPROPYL)PHOSPHONATE
Biological Unit 4 (1, 1)
No.NameCountTypeFull Name
11QY1Ligand/IonTETRADECYL HYDROGEN (R)-(3-AZIDOPROPYL)PHOSPHONATE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:28 , PHE A:29 , SER A:97 , MET A:98 , ALA A:127 , ILE A:128 , GLY A:131 , LEU A:142 , LEU A:170 , VAL A:198 , HIS A:226 , HOH A:548 , HOH A:604BINDING SITE FOR RESIDUE 1QY A 301
2AC2SOFTWAREGLY B:28 , PHE B:29 , GLY B:31 , SER B:97 , MET B:98 , ILE B:125 , ALA B:127 , GLY B:131 , LEU B:138 , LEU B:142 , GLU B:156 , VAL B:198 , HIS B:226 , HOH B:515BINDING SITE FOR RESIDUE 1QY B 301
3AC3SOFTWAREGLY C:28 , PHE C:29 , SER C:97 , MET C:98 , ALA C:127 , ILE C:128 , MET C:132 , LEU C:142 , ILE C:145 , GLY C:146 , SER C:147 , ASP C:148 , GLU C:156 , VAL C:198 , VAL C:199 , HIS C:226 , VAL C:227BINDING SITE FOR RESIDUE 1QY C 301
4AC4SOFTWARELEU B:168 , GLY D:28 , PHE D:29 , SER D:97 , MET D:98 , ILE D:125 , ALA D:127 , ILE D:128 , LEU D:142 , ILE D:145 , GLY D:146 , SER D:147 , ASP D:148 , GLU D:156 , LEU D:170 , VAL D:198 , HIS D:226 , VAL D:227BINDING SITE FOR RESIDUE 1QY D 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4KE8)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4KE8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4KE8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4KE8)

(-) Exons   (0, 0)

(no "Exon" information available for 4KE8)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:248
                                                                                                                                                                                                                                                                                        
               SCOP domains d4ke8a_ A: automated matches                                                                                                                                                                                                                             SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eee....eeeeee.....hhhhhhhhhhhhhhh..eeee........hhhhhhh.hhhhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhh....eeeee.....hhhhhhhhh.......eee.................eeehhhhhhhhhhhhhhhhhhhhh...eeeeee........hhhhhhhhhh....eeeeee.....hhhhh.hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ke8 A   2 SEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA 249
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241        


Chain B from PDB  Type:PROTEIN  Length:248
                                                                                                                                                                                                                                                                                        
               SCOP domains d4ke8b_ B: automated matches                                                                                                                                                                                                                             SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eee....eeeeee.....hhhhhhhhhhhhhhh..eeee........hhhhhhh.hhhhhhhhhhhhhhhhhhhh.eeeeeeehhhhhhhhhhhhhh....eeeee.....hhhhhhhhh.......eee.................eeehhhhhhhhhhhhhhhhhhhhh...eeeeee........hhhhhhhhhh....eeeeee...........hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ke8 B   2 SEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHA 249
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241        


Chain C from PDB  Type:PROTEIN  Length:249
                                                                                                                                                                                                                                                                                         
               SCOP domains d4ke8c_ C: automated matches                                                                                                                                                                                                                              SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eee....eeeeee.....hhhhhhhhhhhhhhh..eeee........hhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhh....eeeee.....hhhhhhhhh.......eee.................eeehhhhhhhhhhhhhhhhhhhhh...eeeeee........hhhhhhhhhh....eeeeee...........hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ke8 C   2 SEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHAG 250
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241         


Chain D from PDB  Type:PROTEIN  Length:249
                                                                                                                                                                                                                                                                                         
               SCOP domains d4ke8d_ D: automated matches                                                                                                                                                                                                                              SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eee....eeeeee.....hhhhhhhhhhhhhhh..eeee........hhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhh....eeeee.....hhhhhhhhh.......eee.................eeehhhhhhhhhhhhhhhhhhhhh...eeeeee........hhhhhhhhhh....eeeeee...........hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4ke8 D   2 SEQYPVLSGAEPFYAENGPVGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGTHYEDMERTTFHDWVASVEEGYGWLKQRCQTIFVTGLSMGGTLTLYLAEHHPDICGIVPINAAVDIPAIAAGMTGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTEKEIVRLRNSYHVATLDYDQPMIIERSLEFFAKHAG 250
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4KE8)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4KE8)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1QY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4ke8)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4ke8
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MGLP_BAC25 | P82597
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.1.23
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MGLP_BAC25 | P82597
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MGLP_BAC25 | P82597: 3rli 3rm3 4ke6 4ke7 4ke9 4kea 4lhe

(-) Related Entries Specified in the PDB File

4ke6 4ke7 4ke9 4kea