Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PHZG FROM BURKHOLDERIA LATA 383
 
Authors :  N. N. Xu, E. G. Ahuja, W. Blankenfeldt
Date :  18 Oct 12  (Deposition) - 07 Aug 13  (Release) - 05 Feb 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.53
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Apo Structure, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. Xu, E. G. Ahuja, P. Janning, D. V. Mavrodi, L. S. Thomashow, W. Blankenfeldt
Trapped Intermediates In Crystals Of The Fmn-Dependent Oxidase Phzg Provide Insight Into The Final Steps Of Phenazine Biosynthesis
Acta Crystallogr. , Sect. D V. 69 1403 2013
PubMed-ID: 23897464  |  Reference-DOI: 10.1107/S0907444913008354

(-) Compounds

Molecule 1 - PYRIDOXAMINE 5'-PHOSPHATE OXIDASE
    ChainsA, B
    EC Number1.4.3.5
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B
    Expression System StrainROSETTA 2 PLYSS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneBCEP18194_B1572
    Organism CommonBURKHOLDERIA CEPACIA
    Organism ScientificBURKHOLDERIA
    Organism Taxid269483
    Strain383

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:45 , ARG A:63 , VAL A:64 , ILE A:65 , ALA A:66 , CYS A:78 , THR A:79 , SER A:83 , ARG A:84 , LYS A:85 , GLN A:142 , SER A:143 , HOH A:401 , HOH A:412 , HOH A:522 , HOH A:555 , TYR B:100 , GLN B:107 , TRP B:185 , ARG B:195 , HOH B:404 , HOH B:407BINDING SITE FOR RESIDUE FMN A 301
2AC2SOFTWARETYR A:100 , GLN A:107 , TRP A:185 , ARG A:195 , HOH A:407 , GLU B:45 , ARG B:63 , VAL B:64 , ILE B:65 , ALA B:66 , CYS B:78 , THR B:79 , SER B:83 , ARG B:84 , LYS B:85 , GLN B:142 , SER B:143 , HOH B:401 , HOH B:413 , HOH B:426 , HOH B:430 , HOH B:583BINDING SITE FOR RESIDUE FMN B 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4HMW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4HMW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4HMW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4HMW)

(-) Exons   (0, 0)

(no "Exon" information available for 4HMW)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:202
                                                                                                                                                                                                                                          
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhh....hhhhhhhhhhhhhhhh......eeeeeee.....eeeeeee..eee..eeeeeee..hhhhhhhhhhheeeeeeee....eeeeeeeeeee.hhhhhhhhhhh.hhhhhhhhhhh.......hhhhhhhhhhhhhhh.........eeeeeeeeeeeeeee.......eeeeeeee..eeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4hmw A  11 GSVDVLFPEYDDPPSEPITLLKRWLATADVARVREPKALALATATSDGRISSRVIAFSSIDDRGVIFCTHSTSRKGRELTETGWASGLLYWRETGQQIMISGQAVPLEESENDKLWFGRSVPMHAMSSASHQSDELVDREALRAHAAELLALGVALPRPPRFVGYRLEPHEMEFWAASSDRLHRRLRYERDGNDWKTTQLQP 212
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210  

Chain B from PDB  Type:PROTEIN  Length:205
                                                                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhh....hhhhhhhhhhhhhhhh......eeeeeee.....eeeeeee..eee..eeeeeee..hhhhhhhhhhheeeeeeee....eeeeeeeeeee.hhhhhhhhhhh.hhhhhhhhhhh.......hhhhhhhhhhhhhhhh........eeeeeeeeeeeeeee.......eeeeeeee..eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4hmw B   8 SLTGSVDVLFPEYDDPPSEPITLLKRWLATADVARVREPKALALATATSDGRISSRVIAFSSIDDRGVIFCTHSTSRKGRELTETGWASGLLYWRETGQQIMISGQAVPLEESENDKLWFGRSVPMHAMSSASHQSDELVDREALRAHAAELLALGVALPRPPRFVGYRLEPHEMEFWAASSDRLHRRLRYERDGNDWKTTQLQP 212
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4HMW)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4HMW)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4HMW)

(-) Gene Ontology  (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4hmw)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4hmw
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q396C5_BURL3 | Q396C5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.4.3.5
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q396C5_BURL3 | Q396C5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q396C5_BURL3 | Q396C54hmx

(-) Related Entries Specified in the PDB File

4hms 4hmt 4hmu 4hmv 4hmx