Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  SERIAL FEMTOSECOND CRYSTALLOGRAPHY STRUCTURE OF A PHOTOSYNTHETIC REACTION CENTER
 
Authors :  L. C. Johansson, D. Arnlund, G. Katona, T. A. White, A. Barty, D. P. Depon R. L. Shoeman, C. Wickstrand, A. Sharma, G. J. Williams, A. Aquila, M. J C. Caleman, J. Davidsson, R. B. Doak, M. Frank, R. Fromme, L. Galli, I. Grotjohann, M. S. Hunter, S. Kassemeyer, R. A. Kirian, C. Kupitz, M. L. Lomb, E. Malmerberg, A. V. Martin, M. Messerschmidt, K. Nass, L. Red M. M. Seibert, J. Sjohamn, J. Steinbrener, F. Stellato, D. Wang, W. Y. W U. Weierstall, S. Westenhoff, N. A. Zatsepin, S. Boutet, J. C. H. Spenc I. Schlichting, H. N. Chapman, P. Fromme, R. Neutze
Date :  09 Oct 13  (Deposition) - 25 Dec 13  (Release) - 14 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.50
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Photosynthesis, Lipidic-Sponge Phase, Reaction Center, Electron Transport, Cell Membrane, Metal- Binding, Transmembrane, Chromophore (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. C. Johansson, D. Arnlund, G. Katona, T. A. White, A. Barty, D. P. Deponte, R. L. Shoeman, C. Wickstrand, A. Sharma, G. J. Williams, A. Aquila, M. J. Bogan, C. Caleman, J. Davidsson, R. B. Doak, M. Frank, R. Fromme, L. Galli, I. Grotjohann, M. S. Hunter, S. Kassemeyer, R. A. Kirian, C. Kupitz, M. Liang, L. Lomb, E. Malmerberg, A. V. Martin, M. Messerschmidt, K. Nass, L. Redecke, M. M. Seibert, J. Sjohamn, J. Steinbrener, F. Stellato, D. Wang, W. Y. Wahlgren, U. Weierstall, S. Westenhoff, N. A. Zatsepin, S. Boutet, J. C. H. Spence, I. Schlichting, H. N. Chapman, P. Fromme, R. Neutze
Structure Of A Photosynthetic Reaction Centre Determined By Serial Femtosecond Crystallography.
Nat. Commun. V. 4 2911 2013
PubMed-ID: 24352554  |  Reference-DOI: 10.1038/NCOMMS3911

(-) Compounds

Molecule 1 - PHOTOSYNTHETIC REACTION CENTER CYTOCHROME C SUBUNIT
    Atcc19567
    ChainsA
    Organism ScientificBLASTOCHLORIS VIRIDIS
    Organism Taxid1079
    Other DetailsDEUTSCHE SAMMLUNG VON MIKROORGANISMEN UND ZELLKULTUREN GMBH (DSMZ)
    SynonymCYTOCHROME C558/C559
 
Molecule 2 - REACTION CENTER PROTEIN L CHAIN
    Atcc19567
    ChainsB
    Organism ScientificBLASTOCHLORIS VIRIDIS
    Organism Taxid1079
    Other DetailsDEUTSCHE SAMMLUNG VON MIKROORGANISMEN UND ZELLKULTUREN GMBH (DSMZ)
    SynonymPHOTOSYNTHETIC REACTION CENTER L SUBUNIT
 
Molecule 3 - REACTION CENTER PROTEIN M CHAIN
    Atcc19567
    ChainsC
    Organism ScientificBLASTOCHLORIS VIRIDIS
    Organism Taxid1079
    Other DetailsDEUTSCHE SAMMLUNG VON MIKROORGANISMEN UND ZELLKULTUREN GMBH (DSMZ)
    SynonymPHOTOSYNTHETIC REACTION CENTER M SUBUNIT
 
Molecule 4 - REACTION CENTER PROTEIN H CHAIN
    Atcc19567
    ChainsD
    Organism ScientificBLASTOCHLORIS VIRIDIS
    Organism Taxid1079
    Other DetailsDEUTSCHE SAMMLUNG VON MIKROORGANISMEN UND ZELLKULTUREN GMBH (DSMZ)
    SynonymPHOTOSYNTHETIC REACTION CENTER H SUBUNIT

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (11, 21)

Asymmetric/Biological Unit (11, 21)
No.NameCountTypeFull Name
1BCL4Ligand/IonBACTERIOCHLOROPHYLL A
2BPB2Ligand/IonBACTERIOPHEOPHYTIN B
3DGA1Ligand/IonDIACYL GLYCEROL
4FE21Ligand/IonFE (II) ION
5FME1Mod. Amino AcidN-FORMYLMETHIONINE
6HEM4Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
7MPG3Ligand/Ion[(Z)-OCTADEC-9-ENYL] (2R)-2,3-BIS(OXIDANYL)PROPANOATE
8MQ71Ligand/IonMENAQUINONE-7
9NS51Ligand/Ion15-CIS-1,2-DIHYDRONEUROSPORENE
10OTP1Ligand/Ion(2E,6E,10E,14E,18E,22E,26E)-3,7,11,15,19,23,27,31-OCTAMETHYLDOTRIACONTA-2,6,10,14,18,22,26,30-OCTAENYLTRIHYDROGEN DIPHOSPHATE
11PO42Ligand/IonPHOSPHATE ION

(-) Sites  (19, 19)

Asymmetric Unit (19, 19)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETYR A:56 , LYS A:57 , ASN A:58 , VAL A:59 , LYS A:60 , VAL A:61 , LEU A:62 , PHE A:70 , MET A:74 , THR A:78 , SER A:82 , CYS A:87 , CYS A:90 , HIS A:91 , TYR A:104 , ALA A:107 , ARG A:108binding site for residue HEM A 401
02AC2SOFTWAREVAL A:81 , TYR A:89 , TYR A:102 , VAL A:106 , MET A:110 , MET A:113 , THR A:114 , CYS A:132 , CYS A:135 , HIS A:136 , PRO A:140 , LEU A:141 , PRO A:142 , LEU A:289 , ARG A:293 , PRO A:301 , HEM A:404binding site for residue HEM A 402
03AC3SOFTWAREVAL A:201 , ARG A:202 , VAL A:203 , VAL A:204 , MET A:233 , SER A:237 , ASN A:243 , CYS A:244 , CYS A:247 , HIS A:248 , PHE A:253 , GLU A:254 , ARG A:264 , ALA A:267 , TRP A:268 , ARG A:272 , TYR B:162 , ILE C:189binding site for residue HEM A 403
04AC4SOFTWAREHIS A:124 , THR A:128 , GLY A:129 , LEU A:240 , GLN A:263 , ALA A:267 , ILE A:271 , MET A:273 , ASP A:304 , CYS A:305 , CYS A:308 , HIS A:309 , THR A:313 , LYS A:314 , PRO A:315 , HEM A:402binding site for residue HEM A 404
05AC5SOFTWARECYS A:1 , TRP B:262 , TRP B:265binding site for residue DGA A 405
06AC6SOFTWAREMET B:174 , VAL B:177 , PHE B:181 , MET B:185 , BCL B:302 , MET C:120 , VAL C:155 , HIS C:180 , BCL C:401 , BPB C:402 , NS5 C:405binding site for residue BCL B 301
07AC7SOFTWAREPHE B:97 , PRO B:124 , MET B:127 , PHE B:128 , LEU B:131 , VAL B:157 , ASN B:158 , PHE B:160 , TRP B:167 , HIS B:168 , HIS B:173 , SER B:176 , PHE B:241 , GLY B:244 , THR B:248 , BCL B:301 , BCL B:303 , BPB B:304 , TYR C:195 , BCL C:401binding site for residue BCL B 302
08AC8SOFTWAREILE B:49 , PHE B:128 , PHE B:146 , ILE B:150 , HIS B:153 , LEU B:154 , VAL B:157 , BCL B:302 , BPB B:304 , TYR C:195 , GLY C:201 , ILE C:204 , GLY C:205 , TYR C:208 , BCL C:401 , OTP C:406binding site for residue BCL B 303
09AC9SOFTWAREILE B:42 , ILE B:49 , ALA B:93 , TRP B:100 , GLU B:104 , VAL B:117 , PHE B:121 , PRO B:124 , TYR B:148 , GLY B:149 , ILE B:150 , HIS B:153 , ALA B:237 , BCL B:302 , BCL B:303 , TYR C:208 , LEU C:212 , MQ7 C:404binding site for residue BPB B 304
10AD1SOFTWARELEU B:119 , SER B:238 , ALA C:1binding site for residue MPG B 305
11AD2SOFTWAREPHE B:179 , LEU B:189 , HIS B:190 , PHE B:216 , SER B:223binding site for residue MPG B 306
12AD3SOFTWAREHIS B:168 , BCL B:301 , BCL B:302 , BCL B:303 , ILE C:69 , MET C:120 , PHE C:148 , PHE C:154 , THR C:185 , PHE C:194 , TYR C:195 , HIS C:200 , SER C:203 , ILE C:204 , TYR C:208 , MET C:275 , ALA C:278 , ILE C:282 , BPB C:402binding site for residue BCL C 401
13AD4SOFTWAREPHE B:181 , MET B:185 , LEU B:189 , BCL B:301 , SER C:63 , SER C:123 , TRP C:127 , ILE C:144 , ASN C:147 , PHE C:148 , SER C:271 , MET C:275 , BCL C:401 , NS5 C:405binding site for residue BPB C 402
14AD5SOFTWAREHIS B:190 , HIS B:230 , HIS C:217 , GLU C:232 , HIS C:264binding site for residue FE2 C 403
15AD6SOFTWARETYR B:29 , ILE B:39 , ARG B:103 , BPB B:304 , HIS C:217 , THR C:220 , ALA C:246 , ALA C:247 , TRP C:250 , ASN C:257 , ALA C:258 , TRP C:266binding site for residue MQ7 C 404
16AD7SOFTWAREBCL B:301 , GLY C:117 , THR C:121 , VAL C:155 , GLY C:159 , CYS C:160 , GLY C:176 , BPB C:402binding site for residue NS5 C 405
17AD8SOFTWAREPHE B:62 , LEU B:151 , BCL B:303 , PRO C:198 , PHE C:206 , CYS C:296 , TRP D:25binding site for residue OTP C 406
18AD9SOFTWARETRP C:23 , TYR C:50 , GLY C:52 , ALA C:53 , SER C:54 , SER C:133binding site for residue PO4 C 408
19AE1SOFTWAREARG C:265binding site for residue PO4 C 409

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4CAS)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Pro A:5 -Pro A:6
2Leu A:152 -Pro A:153
3Gly A:329 -Pro A:330
4Gly C:47 -Pro C:48
5Tyr D:41 -Pro D:42
6Val D:78 -Pro D:79

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4CAS)

(-) PROSITE Motifs  (2, 3)

Asymmetric/Biological Unit (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MULTIHEME_CYTCPS51008 Multiheme cytochrome c family profile.CYCR_BLAVI102-334  1A:82-314
2REACTION_CENTERPS00244 Photosynthetic reaction center proteins signature.RCEL_BLAVI167-193  1B:166-192
RCEM_BLAVI194-220  1C:193-219

(-) Exons   (0, 0)

(no "Exon" information available for 4CAS)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:332
 aligned with CYCR_BLAVI | P07173 from UniProtKB/Swiss-Prot  Length:356

    Alignment length:332
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350  
           CYCR_BLAVI    21 CFEPPPATTTQTGFRGLSMGEVLHPATVKAKKERDAQYPPALAAVKAEGPPVSQVYKNVKVLGNLTEAEFLRTMTAITEWVSPQEGCTYCHDENNLASEAKYPYVVARRMLEMTRAINTNWTQHVAQTGVTCYTCHRGTPLPPYVRYLEPTLPLNNRETPTHVERVETRSGYVVRLAKYTAYSALNYDPFTMFLANDKRQVRVVPQTALPLVGVSRGKERRPLSDAYATFALMMSISDSLGTNCTFCHNAQTFESWGKKSTPQRAIAWWGIRMVRDLNMNYLAPLNASLPASRLGRQGEAPQADCRTCHQGVTKPLFGASRLKDYPELGPIK 352
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......ee............eehhhhhhhhhhhhh..............hhhhhh.........hhhhhhhhhhhhhhhhh..hhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhh..............................hhhhhhhhhhh.........hhhhhhh.....................hhhhh..hhhhhhhhhhhhhhhhhh..hhhhh.hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh.........hhhhhhh...hhhhhh.....hhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------MULTIHEME_CYTC  PDB: A:82-314 UniProt: 102-334                                                                                                                                                                                           ------------------ PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cas A   1 CFEPPPATTTQTGFRGLSMGEVLHPATVKAKKERDAQYPPALAAVKAEGPPVSQVYKNVKVLGNLTEAEFLRTMTAITEWVSPQEGCTYCHDENNLASEAKYPYVVARRMLEMTRAINTNWTQHVAQTGVTCYTCHRGTPLPPYVRYLEPTLPLNNRETPTHVERVETRSGYVVRLAKYTAYSALNYDPFTMFLANDKRQVRVVPQTALPLVGVSRGKERRPLSDAYATFALMMSISDSLGTNCTFCHNAQTFESWGKKSTPQRAIAWWGIRMVRDLNMNYLAPLNASLPASRLGRQGEAPQADCRTCHQGVTKPLFGASRLKDYPELGPIK 332
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330  

Chain B from PDB  Type:PROTEIN  Length:273
 aligned with RCEL_BLAVI | P06009 from UniProtKB/Swiss-Prot  Length:274

    Alignment length:273
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271   
           RCEL_BLAVI     2 ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS 274
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhh..............ee..eehhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            --------------------------------------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cas B   1 ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS 273
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270   

Chain C from PDB  Type:PROTEIN  Length:323
 aligned with RCEM_BLAVI | P06010 from UniProtKB/Swiss-Prot  Length:324

    Alignment length:323
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321   
           RCEM_BLAVI     2 ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIYLGASGIAAFAFGSTAILIILFNMAAEVHFDPLQFFRQFFWLGLYPPKAQYGMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAAAIFFVLCIGCIHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRGTAVERAALFWRWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHGAAPDYPAYLPATPDPASLPGAPK 324
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.....ee..........hhh.ee...ee..hhhhh...ee..ee.hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh..............hhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            -------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4cas C   1 ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIYLGASGIAAFAFGSTAILIILFNMAAEVHFDPLQFFRQFFWLGLYPPKAQYGMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAAAIFFVLCIGCIHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRGTAVERAALFWRWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHGAAPDYPAYLPATPDPASLPGAPK 323
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320   

Chain D from PDB  Type:PROTEIN  Length:243
 aligned with RCEH_BLAVI | P06008 from UniProtKB/Swiss-Prot  Length:258

    Alignment length:258
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250        
           RCEH_BLAVI     1 MYHGALAQHLDIAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVEPLGLVKLAPEDGQVYELPYPKTFVLPHGGTVTVPRRRPETRELKLAQTDGFEGAPLQPTGNPLVDAVGPASYAERAEVVDATVDGKAKIVPLRVATDFSIAEGDVDPRGLPVVAADGVEAGTVTDLWVDRSEHYFRYLELSVAGSARTALIPLGFCDVKKDKIVVTSILSEQFANVPRLQSRDQITLREEDKVSAYYAGGLLYATPERAESLL 258
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhhhhhhhhhh.........---------------.....eeee.....eeee...........eee........eee..hhhhhhhhhhh.................eee.......ee..........eee.....eeeeeeeeeee....eeeeeeeee....eeeeee.hhhee....ee....hhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4cas D   1 mYHGALAQHLDIAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVE---------------ELPYPKTFVLPHGGTVTVPRRRPETRELKLAQTDGFEGAPLQPTGNPLVDAVGPASYAERAEVVDATVDGKAKIVPLRVATDFSIAEGDVDPRGLPVVAADGVEAGTVTDLWVDRSEHYFRYLELSVAGSARTALIPLGFCDVKKDKIVVTSILSEQFANVPRLQSRDQITLREEDKVSAYYAGGLLYATPERAESLL 258
                            |       10        20        30        40    |    -         -|       70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250        
                            1-FME                                      45              61                                                                                                                                                                                                     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4CAS)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4CAS)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4CAS)

(-) Gene Ontology  (17, 47)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (CYCR_BLAVI | P07173)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0019684    photosynthesis, light reaction    The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0030077    plasma membrane light-harvesting complex    A plasma membrane protein-pigment complex that may be closely or peripherally associated to photosynthetic reaction centers that participate in harvesting and transferring radiant energy to the reaction center. Examples of this complex are found in bacterial species.

Chain B   (RCEL_BLAVI | P06009)
molecular function
    GO:0042314    bacteriochlorophyll binding    Interacting selectively and non-covalently with bacteriochlorophyll, a form of chlorophyll found in photosynthetic bacteria, such as the purple and green bacteria. There are several types, designated a to g. Bacteriochlorophyll a and bacteriochlorophyll b are structurally similar to the chlorophyll a and chlorophyll b found in plants.
    GO:0016168    chlorophyll binding    Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
    GO:0045156    electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity    Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0019684    photosynthesis, light reaction    The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
    GO:0009772    photosynthetic electron transport in photosystem II    A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030077    plasma membrane light-harvesting complex    A plasma membrane protein-pigment complex that may be closely or peripherally associated to photosynthetic reaction centers that participate in harvesting and transferring radiant energy to the reaction center. Examples of this complex are found in bacterial species.
    GO:0042717    plasma membrane-derived chromatophore membrane    The lipid bilayer associated with a plasma membrane-derived chromatophore; surrounds chromatophores that form complete vesicles.

Chain C   (RCEM_BLAVI | P06010)
molecular function
    GO:0042314    bacteriochlorophyll binding    Interacting selectively and non-covalently with bacteriochlorophyll, a form of chlorophyll found in photosynthetic bacteria, such as the purple and green bacteria. There are several types, designated a to g. Bacteriochlorophyll a and bacteriochlorophyll b are structurally similar to the chlorophyll a and chlorophyll b found in plants.
    GO:0016168    chlorophyll binding    Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
    GO:0045156    electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity    Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0019684    photosynthesis, light reaction    The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
    GO:0009772    photosynthetic electron transport in photosystem II    A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030077    plasma membrane light-harvesting complex    A plasma membrane protein-pigment complex that may be closely or peripherally associated to photosynthetic reaction centers that participate in harvesting and transferring radiant energy to the reaction center. Examples of this complex are found in bacterial species.
    GO:0042717    plasma membrane-derived chromatophore membrane    The lipid bilayer associated with a plasma membrane-derived chromatophore; surrounds chromatophores that form complete vesicles.

Chain D   (RCEH_BLAVI | P06008)
molecular function
    GO:0042314    bacteriochlorophyll binding    Interacting selectively and non-covalently with bacteriochlorophyll, a form of chlorophyll found in photosynthetic bacteria, such as the purple and green bacteria. There are several types, designated a to g. Bacteriochlorophyll a and bacteriochlorophyll b are structurally similar to the chlorophyll a and chlorophyll b found in plants.
    GO:0016168    chlorophyll binding    Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
    GO:0045156    electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity    Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0019684    photosynthesis, light reaction    The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030077    plasma membrane light-harvesting complex    A plasma membrane protein-pigment complex that may be closely or peripherally associated to photosynthetic reaction centers that participate in harvesting and transferring radiant energy to the reaction center. Examples of this complex are found in bacterial species.
    GO:0042717    plasma membrane-derived chromatophore membrane    The lipid bilayer associated with a plasma membrane-derived chromatophore; surrounds chromatophores that form complete vesicles.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BCL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BPB  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DGA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FE2  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FME  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MPG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MQ7  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NS5  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OTP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:329 - Pro A:330   [ RasMol ]  
    Gly C:47 - Pro C:48   [ RasMol ]  
    Leu A:152 - Pro A:153   [ RasMol ]  
    Pro A:5 - Pro A:6   [ RasMol ]  
    Tyr D:41 - Pro D:42   [ RasMol ]  
    Val D:78 - Pro D:79   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4cas
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYCR_BLAVI | P07173
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RCEH_BLAVI | P06008
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RCEL_BLAVI | P06009
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  RCEM_BLAVI | P06010
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CYCR_BLAVI | P07173
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RCEH_BLAVI | P06008
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RCEL_BLAVI | P06009
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RCEM_BLAVI | P06010
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CYCR_BLAVI | P071731dxr 1prc 1r2c 1vrn 2i5n 2jbl 2prc 2wjm 2wjn 2x5u 2x5v 3d38 3g7f 3prc 3t6d 3t6e 4ac5 5m7j 5m7k 5m7l 5prc 6prc 7prc
        RCEH_BLAVI | P060081dxr 1prc 1r2c 1vrn 2i5n 2jbl 2prc 2wjm 2wjn 2x5u 2x5v 3d38 3g7f 3prc 3t6d 3t6e 4ac5 5m7j 5m7k 5m7l 5prc 6prc 7prc
        RCEL_BLAVI | P060091dxr 1prc 1r2c 1vrn 2i5n 2jbl 2prc 2wjm 2wjn 2x5u 2x5v 3d38 3g7f 3prc 3t6d 3t6e 4ac5 5m7j 5m7k 5m7l 5prc 6prc 7prc
        RCEM_BLAVI | P060101dxr 1prc 1r2c 1vrn 2i5n 2jbl 2prc 2wjm 2wjn 2x5u 2x5v 3d38 3g7f 3prc 3t6d 3t6e 4ac5 5m7j 5m7k 5m7l 5prc 6prc 7prc

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4CAS)