Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF LEGIONELLA PNEUMOPHILA RALF F255K MUTANT
 
Authors :  M. Folly-Klan, E. Alix, D. Stalder, P. Ray, L. V. Duarte, A. Delprato, M. B. Antonny, V. Campanacci, C. R. Roy, J. Cherfils
Date :  24 Sep 13  (Deposition) - 04 Dec 13  (Release) - 04 Dec 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.10
Chains :  Asym./Biol. Unit :  A
Keywords :  Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Folly-Klan, E. Alix, D. Stalder, P. Ray, L. V. Duarte, A. Delprato, M. Zeghouf, B. Antonny, V. Campanacci, C. R. Roy, J. Cherfils
A Novel Membrane Sensor Controls The Localization And Arfgef Activity Of Bacterial Ralf.
Plos Pathog. V. 9 3747 2013
PubMed-ID: 24244168  |  Reference-DOI: 10.1371/JOURNAL.PPAT.1003747

(-) Compounds

Molecule 1 - RALF
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPHIS1
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VariantSTAR
    Expression System Vector TypePLASMID
    MutationYES
    Organism ScientificLEGIONELLA PNEUMOPHILA
    Organism Taxid272624
    StrainPHILADELPHIA STRAIN 1
    SynonymGUANINE EXCHANGE FACTOR RALF

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1GOL1Ligand/IonGLYCEROL

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:289BINDING SITE FOR RESIDUE GOL A1348

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4C7P)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4C7P)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4C7P)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4C7P)

(-) Exons   (0, 0)

(no "Exon" information available for 4C7P)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:347
 aligned with Q8RT31_LEGPN | Q8RT31 from UniProtKB/TrEMBL  Length:374

    Alignment length:347
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       
         Q8RT31_LEGPN     1 MHPEIEKAQREIIEAFNAKPKNGINKIKEICEQYKISPNEEIAEFFHQQRKNLDLEAVGDYLSSPEAENQQVLKAFTSQMNFNGQSFVEGLRTFLKTFKLPGEAQKIDRLVQSFSGAYFQQNPDVVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTVDGLKRNLRGGNNGGDFDAKFLEELYSEIKAKPFELNFVKTSPGYELTSTTLNKDSTFKKLDSFLHSTDVNINTVFPGIGDNVKTTVDQPKSWLSFFTGYKGTITLTDNKTSAQATIQVYTPNIFSKWLFGEQPRVIIQPGQTKESIDLAAKAAADFSSPVKNFKATYDYEVGDLIKAYDNQKKLITIE 347
               SCOP domains d4c7pa1 A:1-197 automated matches                                                                                                                                                                    d4c7pa2 A:198-347 automated matches                                                                                                                    SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh....hhhhhhhhhh..hhhhhhhhhhhhhh......hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh...hhhhh.hhhhhhhhh.........hhhhhhhhhhhhhhh...........eeeee..hhhhhhhhhhhhhhhh....hhhhh.......eeeeee.....hhhhh.eeeeeeeee.....eeeeeee.....hhhhhh...eeeeee....hhhhhhhhhhhhh.....eee.....hhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4c7p A   1 SHPEIEKAQREIIEAFNAKPKNGINKIKEICEQYKISPNEEIAEFFHQQRKNLDLEAVGDYLSSPEAENQQVLKAFTSQMNFNGQSFVEGLRTFLKTFKLPGEAQKIDRLVQSFSGAYFQQNPDVVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTVDGLKRNLRGGNNGGDFDAKFLEELYSEIKAKPFELNFVKTSPGYELTSTTLNKDSTFKKLDSFLHSTDVNINTVFPGIGDNVKTTVDQPKSWLSFKTGYKGTITLTDNKTSAQATIQVYTPNIFSKWLFGEQPRVIIQPGQTKESIDLAAKAAADFSSPVKNFKATYDYEVGDLIKAYDNQKKLITIE 347
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4C7P)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4C7P)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q8RT31_LEGPN | Q8RT31)
molecular function
    GO:0005086    ARF guanyl-nucleotide exchange factor activity    Stimulates the exchange of guanyl nucleotides associated with the GTPase ARF. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
biological process
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
    GO:0032012    regulation of ARF protein signal transduction    Any process that modulates the frequency, rate or extent of ARF protein signal transduction.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4c7p)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4c7p
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8RT31_LEGPN | Q8RT31
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8RT31_LEGPN | Q8RT31
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8RT31_LEGPN | Q8RT311xsz 1xt0 4d7q 4d7r

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4C7P)