|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 3)
Asymmetric/Biological Unit (1, 3)
|
Sites (0, 0)| (no "Site" information available for 1XT0) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1XT0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1XT0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1XT0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1XT0) |
Exons (0, 0)| (no "Exon" information available for 1XT0) |
Sequences/Alignments
Asymmetric/Biological UnitChain B from PDB Type:PROTEIN Length:203 aligned with Q8RT31_LEGPN | Q8RT31 from UniProtKB/TrEMBL Length:374 Alignment length:203 1 | 8 18 28 38 48 58 68 78 88 98 108 118 128 138 148 158 168 178 188 198 Q8RT31_LEGPN - --MHPEIEKAQREIIEAFNAKPKNGINKIKEICEQYKISPNEEIAEFFHQQRKNLDLEAVGDYLSSPEAENQQVLKAFTSQMNFNGQSFVEGLRTFLKTFKLPGEAQKIDRLVQSFSGAYFQQNPDVVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTVDGLKRNLRGGNNGGDFDAKFLEELYSEIKAKPFELNFVKTSP 201 SCOP domains d1xt0b_ B: RalF, N-terminal domain SCOP domains CATH domains 1xt0B01 B:-1-79 [code=1.10.220.20, no name defined] -1xt0B02 B:81-201 Arf Nucleotide-binding Site Opener,domain 2 CATH domains Pfam domains ----Sec7-1xt0B01 B:3-192 --------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1xt0 B -1 GASHPEIEKAQREIIEAFNAKPKNGINKIKEICEQYKISPNEEIAEFFHQQRKNLDLEAVGDYLSSPEAENQQVLKAFTSQmNFNGQSFVEGLRTFLKTFKLPGEAQKIDRLVQSFSGAYFQQNPDVVSNADAAYLLAFQTImLNTDLHNPSIPEKNKmTVDGLKRNLRGGNNGGDFDAKFLEELYSEIKAKPFELNFVKTSP 201 8 18 28 38 48 58 68 78 | 88 98 108 118 128 138 | 148 158 168 178 188 198 80-MSE 141-MSE 157-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (2, 2)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain B (Q8RT31_LEGPN | Q8RT31)
|
||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|